![Tasty chocolate glazed protein bars and granola with berries falling on white background Image of Tasty chocolate glazed protein bars and granola with berries falling on white background](https://static.africaimages.com/photos/8/M/8Mm5QJgzQiUquXctVsDZfZZg6/8Mm5QJgzQiUquXctVsDZfZZg6_normal.jpg)
Tasty chocolate glazed protein bars and granola with berries falling on white background
Stock Photo ID: 773004
Large 8992 × 13297 px, JPG 317.22 × 469.09 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Tasty chocolate glazed protein bars and granola with berries falling on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8992 × 13297 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 29 Jul 2021
You may use our image “Tasty chocolate glazed protein bars and granola with berries falling on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbarsberriesblueberrycerealchocolatecocoacollagedeliciousdessertdietdifferenteatenergyfallfallingfitnessflakesflyflyingfoodglazedgranolagrouphealthyingredientisolatedlossmanymealmotionmueslinaturalnutritionoatobjectorganicproteinraspberrysnacksportstrawberrysupplementsweettastyveganvegetarianweightwhite
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Revitalize your visual content with the latest stock images
Your go-to online photo stock provides the perfect place for you to immerse yourself in creativity. Enjoy a constant flow of fresh content, including a collection of unique photos not available elsewhere. We also have a huge free image gallery covering an array of topics whereas our blog gives you invaluable ideas, tactics, and techniques on how to use stock imagery for business and creative growth. These additional benefits and features of our service make us a popular choice for content creators and business owners alike to upgrade both commercial and non-commercial projects. Reap the rewards of using our site today and enjoy amazing new content for your campaigns.
Trust from all aspects of stock image solutions beyond pixels
Looking for a photo stock that has the latest images as well as offers a secure and smooth purchase process? This platform sets new standards for reliability. Backed by security procedures designed to give you total assurance as you browse the site, its user-friendly interface will help you effortlessly search among our large and diverse collections to find exactly what you need. Complementing this, a group of dedicated customer service professionals is on hand to respond promptly to your questions and help you with any purchases. When looking online for the latest stock photos, make us your go-to destination, where reliability and security seamlessly blend with user-centered design.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.