Tasty chocolate glazed protein bars and granola with berries falling on white background
Stock Photo ID: 772996
Large 6298 × 9591 px, JPG 222.18 × 338.35 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Tasty chocolate glazed protein bars and granola with berries falling on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6298 × 9591 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 28 Jul 2021
You may use our image “Tasty chocolate glazed protein bars and granola with berries falling on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbarsberriesblueberrycerealchocolatecocoacollagedeliciousdessertdietdifferenteatenergyfallfallingfitnessflakesflyflyingfoodglazedgranolagrouphealthyingredientisolatedlossmanymealmotionmueslinaturalnutritionoatobjectorganicproteinraspberrysnacksportstrawberrysupplementsweettastyveganvegetarianweightwhite
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
Get additional benefits beyond quality images with our photo stock
Have a taste of innovation with our premium and trusted online photo stock. Creative professionals can stay up to date with the latest trends and popular themes thanks to new images loaded daily on the platform. Filter and download your perfect picture from our free gallery that covers diverse topics, including business, transport, fashion, and much more. In our blog, you will discover best practices in using your new high-resolution stock images in business and creative activities. Choose us for additional services that will elevate your visual experience, going beyond the norm to deliver outstanding results for you and your brand.
Security-backed downloads with customer support and much more
Discover an online image provider that is extraordinary in every respect. By going beyond normal standards, we are a trustworthy option for those who demand the highest levels of service and the latest trending photos. A browse of our huge collection of images is secured by strong data and payment safety measures, and the interface with high usability makes navigation easy. Additional features of our service include excellent customer support at the ready to help and enhance your experience. Security, a user-friendly design, and endless support, when it’s needed, come together to transform entirely how you think of stock images on the web.
Get more value for your money with our on-demand stock image packs
Use our license comparison table to choose exactly what you need when it comes to our image pricing plans. It helpfully sets out what usage is allowed with each plan so you can select a package that works for your project needs. You can save time and money with our bulk savings on both the Standard and Extended options, with discounts on offer for the more photos you purchase. Looking to do more with your downloads when it comes to sales and distribution? Only our Extended license allows the use of our image content in the creation of any product for sale or distribution, digital templates for sale and distribution, and for business or commercial space designs.