Zen concept. Stone, leaves and pattern on beige sand, closeup. Space for text
Stock Photo ID: 1634159
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Zen concept. Stone, leaves and pattern on beige sand, closeup. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 3 Feb 2024
You may use our image “Zen concept. Stone, leaves and pattern on beige sand, closeup. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
asianbackgroundbalancebeigebuddhismcalmcloseupconcentrationconceptcopyculturegardenharmonyhealthjapaneseleaveslifestylelinesmeditationmentalmindnatureobjectorientalpatternpeacepebblepracticerelaxrelaxationrocksandserenitysilencesimplesoulspaspacespiritspiritualstabilitystonetexttexturetraditionaltranquiltranquilitytreatmentwellnesszen
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.