Image of Young woman waiting for public transport at bus stop
Release info: model and property release for this stock photo is signed with Africa Studio.

Young woman waiting for public transport at bus stop

Stock Photo ID: 784174
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Young woman waiting for public transport at bus stop”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Aug 2021
You may use our image “Young woman waiting for public transport at bus stop” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.

Find stock photos using keywords

adultadventurebackgroundbackpackbusbusinesscaucasiancitydowntownfemalegirlglasseshappyhipsterinfrastructurejourneylifestylelocationmodernoutdoorspassengerpersonpublicservicesmilingstationstopstreetstyletouristtowntraffictramtransittransporttransportationtraveltravelertriptrolleyurbanwaitingwomanyoung

Similar stock images

Image of Young man in protective mask talking on phone while waiting for public transport at bus stop
Young man in protective mask talking on phone while waiting for public transport at bus stop
Image of Young woman near public transport map at bus stop
Young woman near public transport map at bus stop
Image of Young woman waiting for public transport at bus stop
Young woman waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman in protective mask waiting for public transport at bus stop
Young woman in protective mask waiting for public transport at bus stop
Image of Young woman in protective mask waiting for public transport at bus stop
Young woman in protective mask waiting for public transport at bus stop
See All

Same model

Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Image of Double exposure of successful business team and cityscape
Double exposure of successful business team and cityscape
Image of Choice of profession. Inscription We Will Be and different occupations written over students on light blue background
Choice of profession. Inscription We Will Be and different occupations written over students on light blue background
Image of Choice of profession. Inscription We Will Be and different occupations written over students. Group of people near green wall
Choice of profession. Inscription We Will Be and different occupations written over students. Group of people near green wall
Image of Pediatrician consulting patient online using video chat in clinic, view from webcam
Pediatrician consulting patient online using video chat in clinic, view from webcam
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
See All

Africa Images: where quality and creativity come together in harmony

Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.

Craft strong narratives with stock photos for visual storytelling

In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.

Enhance your content campaigns with unique image categories

We have millions of photos that get updated regularly, so you can easily find the right photos that reflect your vision and perfectly illustrate your projects. You can browse, download, and purchase from the extensive collection of innovative, current, and trending stock images to stay one step ahead of the competition. From home interiors to spas and seasonal, no matter what business you work in, or your role, there’s plenty of choice and a variety of pictures available. For your convenience, all our stock photos are arranged by category, making it quicker to find exactly what you need for your initiatives.

Take advantage of our additional image services and benefits

Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.

Reliability is a guarantee that goes beyond pixels, and each click

Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.

We provide a pleasant shopping experience on our easy-to-use site

Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.