Image of Young woman waiting for public transport at bus stop
Release info: model and property release for this stock photo is signed with Africa Studio.

Young woman waiting for public transport at bus stop

Stock Photo ID: 784168
Large 6720 × 4241 px, JPG 237.07 × 149.61 cm
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Young woman waiting for public transport at bus stop”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4241 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Aug 2021
You may use our image “Young woman waiting for public transport at bus stop” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.

Find stock photos using keywords

adultadventurebackgroundbackpackbusbusinesscaucasiancitydowntownfemalegirlglasseshappyhipsterinfrastructurejourneylifestylelocationmapmodernoutdoorspassengerpersonpublicservicesmilingstationstopstreetstyletouristtowntraffictramtransittransporttransportationtraveltravelertriptrolleyurbanwaitingwomanyoung

Similar stock images

Image of Young man in protective mask talking on phone while waiting for public transport at bus stop
Young man in protective mask talking on phone while waiting for public transport at bus stop
Image of Young woman near public transport map at bus stop
Young woman near public transport map at bus stop
Image of Young woman waiting for public transport at bus stop
Young woman waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman checking time while waiting for public transport at bus stop
Young woman checking time while waiting for public transport at bus stop
Image of Young woman in protective mask waiting for public transport at bus stop
Young woman in protective mask waiting for public transport at bus stop
Image of Young woman in protective mask waiting for public transport at bus stop
Young woman in protective mask waiting for public transport at bus stop
See All

Same model

Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Image of Double exposure of successful business team and cityscape
Double exposure of successful business team and cityscape
Image of Choice of profession. Inscription We Will Be and different occupations written over students on light blue background
Choice of profession. Inscription We Will Be and different occupations written over students on light blue background
Image of Choice of profession. Inscription We Will Be and different occupations written over students. Group of people near green wall
Choice of profession. Inscription We Will Be and different occupations written over students. Group of people near green wall
Image of Pediatrician consulting patient online using video chat in clinic, view from webcam
Pediatrician consulting patient online using video chat in clinic, view from webcam
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
Photo of People clinking glasses of red wine at served table, closeup
People clinking glasses of red wine at served table, closeup
See All

Collection of high-quality images

Photo of Young woman with camera taking photo on city street. Interesting hobby
Young woman with camera taking photo on city street. Interesting hobby
Photo of Couple of travelers with map on city street
Couple of travelers with map on city street
Photo of Traveler with backpack taking picture on city street, back view
Traveler with backpack taking picture on city street, back view
Photo of Travel blogger using laptop on stone outdoors, space for text
Travel blogger using laptop on stone outdoors, space for text
Photo of Travel blogger recording video on city street, space for text
Travel blogger recording video on city street, space for text
Photo of Travel blogger with magnifying glass and map planning trip, top view
Travel blogger with magnifying glass and map planning trip, top view
Photo of Travel blogger on stone looking at beautiful view outdoors, space for text
Travel blogger on stone looking at beautiful view outdoors, space for text
Photo of Travel blogger with smartphone and tripod streaming outdoors, space for text
Travel blogger with smartphone and tripod streaming outdoors, space for text
Photo of Travel blogger with backpack using laptop outdoors
Travel blogger with backpack using laptop outdoors
See All

Create stunning visuals with Africa Images’ stock photography

Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.

Why you should use highly visual stock images for business growth

Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.

Visual brilliance awaits exploration with our photo collections

Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.

Benefit from constant new visual content with our photo stock

Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.

Reliability is a guarantee that goes beyond pixels, and each click

Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.

From finding your perfect image to making a payment, we make it easy

Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.