Young courier with thermo bag and paper package on color background, space for text. Food delivery service
Stock Photo ID: 309373
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Young courier with thermo bag and paper package on color background, space for text. Food delivery service”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 3 Dec 2018
You may use our image “Young courier with thermo bag and paper package on color background, space for text. Food delivery service” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbackpackbagboybusinesscaucasiancolorcontainercopycourierdeliverdeliveringdeliverydeliverymandisposableexpressfastfoodhandsomehappyholdingjoblunchmalemanmealoccupationorderpackagepaperpersonpizzaportraitprofessionredrefrigeratorrestaurantservicesmilingspacetakeawaytakeouttextthermalthermoworkyoung
Africa Images: the smart photo stock choice for your business
As a popular and trusted supplier of royalty-free stock photos covering a wide range of themes and topics, our collections are ideal for use in commercial and non-commercial projects. With a team of experts who not only update the galleries daily but also monitor the latest trends, you can have confidence that our high-resolution images are not only relevant but also of the best quality. We pay great attention to every detail — be it a chair, plate of food, or laptop, that is featured in our pictures. No matter the size or resolution you need, you will be able to choose the perfect picture that best suits your creative needs from our user-friendly website.
Shape your brand narratives with high-resolution stock photos
In a well-planned marketing campaign, imagery can play a crucial role in telling your brand’s story. It provides those all-important visual clues to both existing and new customers, which will help them align with your business and understand how it could fit into their lives. With the potential to evoke specific emotions, stock images can be a powerful way to build strong customer relationships and convey your brand’s story. The variety and quality of photos available at Africa Images will help to get your point across quickly while saving time and money, helping to increase conversions and provide a richer customer experience.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get great savings when you buy in bulk from our photo stock
Not only is the process of finding quality images on our website quick, simple, and inspiring, but you will also be pleasantly surprised by our prices. It can be daunting when trying to navigate how image licenses work, but our useful comparison section outlines exactly what usage rights are included with our Standard and Extended on-demand pricing packs. With both options, the more pictures you purchase, the more value you will get with bulk savings. Wondering how you can maximize our content on popular printed reproductions and outdoor advertising? Then, the Extended license with unlimited use is the right choice for you.