
Young courier with pizza boxes and drinks on white background. Food delivery service
Stock Photo ID: 311098
Large 5944 × 6360 px, JPG 209.69 × 224.37 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Young courier with pizza boxes and drinks on white background. Food delivery service”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5944 × 6360 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 3 Dec 2018
You may use our image “Young courier with pizza boxes and drinks on white background. Food delivery service” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundboxesboybusinesscardboardcartoncaucasiancoffeecontainercouriercupsdeliverdeliverydeliverymandrinkdrinksexpressfastfoodgestureguyhandsomehappyholdingisolatedjoblunchmalemanmealoccupationorderpackagepersonpizzaportraitprofessionrestaurantservicesmilingtakeawaytakeoutteathumbsupwhiteworkworkeryoung
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Let us provide royalty-free visual investments for your brand
High-resolution stock photos exist so that content creators and businesses can easily find an image that’s already available, offering convenience and saving time, resources, and money. Once an image is downloaded from the website, you will have access to it immediately, which means no waiting for post-production editing before you can start to use your photo. This is just one of the many features and benefits of our service to elevate your brand’s creative output and appeal. These royalty-free photos are an invaluable resource and investment for designers, business owners, teachers, bloggers, and marketers wanting to produce high-quality, professional content.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.