Words No War made of wooden letters on soil, top view
Stock Photo ID: 1118580
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Words No War made of wooden letters on soil, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 7 Dec 2022
You may use our image “Words No War made of wooden letters on soil, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aggressionannexationarmyassumptionbackgroundbattlecapturecasualtiescivilconceptconflictconquestcrisisdangerdangerousdeathdenazificationdestructionfascismflatgenocideindependenceinvasionlaylettersmademilitarynationnazisnonobodyobjectoccupationpeacepeacekeepingsadnesssoiltoptragedytragicvictimsviewwarwarfareweaponswoodenwordwordsworld
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Discover the transformative power of stock pictures for your campaigns
Pictures can alter how stories are told, brands are marketed, and communication is conducted in a world where conventional spaces blend with an ever-increasing digital presence. These aspects can surpass language barriers, stimulate feelings and emotions, and provide the highest engagement level. With a purchase of our licensed high-resolution stock photos, you can take confidence and pride in the fact that your creative integrity is protected along with that of the image creator. Discover our ever-evolving and growing stock photo resource for royalty-free visuals where each image is a storyteller, creating a lasting and memorable impression.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Get trending photos, free pictures, blog content, and more with us
Take your visual content further with our established photo stock. We offer unique benefits such as a never-ending flow of new content and distinct pictures that distinguish us from the competition. From health to celebrations and relationships, explore our wide-ranging free gallery that features various themes over 100 pages of content. Select the orientation, color, image type, isolation, and more to find exactly what you need for your materials. Want to get the best out of your downloaded images? Head to our blog section for informative articles on how you can maximize creativity and engagement in your upcoming campaigns.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.