![Woman working with tablet at wooden table, top view Photo of Woman working with tablet at wooden table, top view](https://static.africaimages.com/photos/L/t/LtZ1VwcjoaDTmv7VdTzoHMmWy/LtZ1VwcjoaDTmv7VdTzoHMmWy_normal.jpg)
Woman working with tablet at wooden table, top view
Stock Photo ID: 1345359
Large 8192 × 5464 px, JPG 289 × 192.76 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Woman working with tablet at wooden table, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 8192 × 5464 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 10 Apr 2023
You may use our image “Woman working with tablet at wooden table, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aboveadultbackgroundblankbusinessbusinesswomancloseupcommunicationdesigndeskdevicedigitaldisplayemployeeemptyexecutivefemalegadgethandsinternetjoblifestylemanagermodernnetworkoccupationofficeonlinepersonportableprofessionalscreenspacesuccesstabletablettechnologytopusingviewwomanwoodenworkworkerworkingworkplace
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
The importance of the strategic use of stock photos in marketing
An important element that stock images can add to marketing campaigns is how people see themselves within your brand advert. Our vast and varied photo stock provides users with thousands of aspirational visuals your brand can tap into. These royalty-free images are a valuable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content and creative output. A high-resolution photo can inspire and create motivation in the audience to become brand advocates and supporters. Take advantage of this opportunity to sell more of your products by strategically using our images to promote your brand.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
Discover a photo stock where creativity meets uniqueness
Keep your creative projects on top with our daily updated photos. Take advantage of a selection of out-of-the-ordinary pictures and illustrations only available on this site, while checking out a free image gallery that includes a broad range of categories over 130 pages, including sports, food, cosmetics, and much more. Read our informative blog posts that give helpful hints and tips on how to better use our stock images in your business activities and design work. These are just some of the additional features and benefits of our photo stock service that are popular with business owners, marketers, designers, teachers, and bloggers.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.