Woman working with modern laptop at wooden table, closeup. Space for design
Stock Photo ID: 549173
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Woman working with modern laptop at wooden table, closeup. Space for design”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 15 Jun 2020
You may use our image “Woman working with modern laptop at wooden table, closeup. Space for design” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultapartmentbackgroundblankblogbloggerbusinessbusinesswomancloseupcoffeecommunicationcomputercopycupdesigndeskdevicedisplaydrinkfemalefreelancerhandshomeindoorsinformationinternetlaptoplifestylemockmockupmodernnotebookofficeonlinepersonroomscreenspacestationerystyletabletechnologytextupusingwomanwoodenworkworking
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
High-quality stock photos can be transformative across industries
High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Do more with less, thanks to our cost-effective pricing options
With so much choice on offer online when it comes to stock images, finding a provider who not only has the best quality and most diverse range of pictures available but also makes the user experience simple yet effective from start to finish can be difficult. Not with our photo stock. Our Standard and Extended on-demand pricing packs give you options when it comes to the number of images per download, with cost savings available for the more you buy. The more photos you download, the more creative you can be in your projects. Take advantage of our platform today.