Free
Free image Woman with thermos and cup lid on green grass in autumn, closeup
Stock Photo ID: 1474312
Large 4480 × 6720 px, JPG 158.04 × 237.07 cm
DescriptionImage Usage
What is a free image “Woman with thermos and cup lid on green grass in autumn, closeup”? It's a perfect solution when your photography budget is limited! We offer a free high-quality stock photo that may be used for any non-commercial projects. You can download it without any charges on Africa Images photo stock in high resolution up to 4480 × 6720 px or even form your own free images collection with other pictures in it. Simply put the heart under every photo or illustration you like for an effortless review and match.
Upload date: 28 Oct 2023
You may use our free image “Woman with thermos and cup lid on green grass in autumn, closeup” for advertising, social networks, websites, mobile applications, programs, electronic publishing, and mass media as long as you indicate the reference to an image source (website https://africaimages.com) and mention Africa Studio Company. It is prohibited to use this free image for commercial purposes, such as merchandise, product sale, and free distribution, or make it a part of your brand or make a business logo with them. It also should not be used for sending spam email campaigns, infringing property rights, or being a part of any illegal or immoral activities. In addition, this photo cannot be used in a political context or for selling tobacco and alcohol products. Find out more in our Free license agreement.
Find stock photos using keywords
aluminumautumnbackgroundbeveragebottlecampingchromecloseupcoffeecontainercupdaydesigndrinkfallfemaleflaskforestgrassgreenhandhikinghotleisurelidlifestyleliquidmetalnatureoutdoorsparkpersonpicnicreusablestainlesssteelsunnyteatemperaturethermalthermothermostourismtraveltripvacationvacuumverticalwarmwoman
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get great savings when you buy in bulk from our photo stock
Not only is the process of finding quality images on our website quick, simple, and inspiring, but you will also be pleasantly surprised by our prices. It can be daunting when trying to navigate how image licenses work, but our useful comparison section outlines exactly what usage rights are included with our Standard and Extended on-demand pricing packs. With both options, the more pictures you purchase, the more value you will get with bulk savings. Wondering how you can maximize our content on popular printed reproductions and outdoor advertising? Then, the Extended license with unlimited use is the right choice for you.