Woman with powdered infant formula at table, closeup and space for text. Preparing baby milk
Stock Photo ID: 874696
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Woman with powdered infant formula at table, closeup and space for text. Preparing baby milk”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 19 Nov 2021
You may use our image “Woman with powdered infant formula at table, closeup and space for text. Preparing baby milk” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbabybackgroundblankcancarechildcloseupcopydairydietdrinkdryeatfeedfeedingfemalefoodformulahandhealthyinfantingredientkitchenlactosematernitymealmeasuringmilkmothermotherhoodnewbornnursingnutritionnutritiousorganicpersonpowderpowderedpreparationpreparepreparingscoopspacespoontabletextwhitewomanyellow
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Shape your brand narratives with high-resolution stock photos
In a well-planned marketing campaign, imagery can play a crucial role in telling your brand’s story. It provides those all-important visual clues to both existing and new customers, which will help them align with your business and understand how it could fit into their lives. With the potential to evoke specific emotions, stock images can be a powerful way to build strong customer relationships and convey your brand’s story. The variety and quality of photos available at Africa Images will help to get your point across quickly while saving time and money, helping to increase conversions and provide a richer customer experience.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From payment to download, experience a seamless online journey
As a leading online supplier of stock images, users can experience great customer satisfaction from start to finish when it comes to downloading their chosen pictures. The process of finding exactly what you are looking for and comparing the different license plans available results in an enhanced purchase interaction. You can choose from a Standard or Extended on-demand pack depending on how you plan to use your new downloads. Both options also provide savings when purchasing in bulk. So not only is this more cost-effective but it means you can bank these additional photos for future use in your work initiatives.