
Woman suffering from seasonal spring allergy on green grass in park. Space for text
Stock Photo ID: 1377826
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Woman suffering from seasonal spring allergy on green grass in park. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 25 May 2023
You may use our image “Woman suffering from seasonal spring allergy on green grass in park. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultallergenallergicallergiesallergyasthmabackgroundbadcaucasiancoldcopydiseaseenvironmentfemalegrassgreenhealthillnessinfectioninfluenzalawnlifemedicinenapkinnasalnaturalnoseoutdoorsoutsideparkpersonpollenportraitproblemseasonalsicknesssittingsneezespacespringsufferingsymptomsymptomstexttissuetreatmentunhealthyunwellwomanyellow
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Help your brand standout with a wide range of image categories
Our expertly curated photo stock collections ensure you get a highly visual experience that speaks volumes about style and excellence. With categories dedicated to everyday scenes as well as more specialist subjects, we regularly update our collections, so they reflect the latest trends and popular materials, including stunning home decor, sleek salons, and spas, as well as appetizing scenes for fresh food and drinks. Think of a theme or have an image idea for your next project, and we will likely have it on our website. Simply browse our extensive collections for inspiration and that perfect picture before downloading and using your photos.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Business owners love our photo stock for the purchasing experience
We are a trusted supplier of stock images because we offer our users an efficient and enjoyable experience when using our platform. This, combined with payment protection and cost-effective pricing plans, means that you get a full suite of features and benefits that you likely won’t find with other providers. From browsing to selecting, purchasing, downloading, and using your new images, it only takes a matter of minutes from start to finish. Review our license comparison summary for what is allowed and included with each package so you know whether our Standard or Extended options are best for your creative requirements.