Woman suffering from cough isolated on white
Stock Photo ID: 360434
Large 3717 × 3929 px, JPG 131.13 × 138.61 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Woman suffering from cough isolated on white”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 3717 × 3929 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 6 Feb 2019
You may use our image “Woman suffering from cough isolated on white” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
acheadultallergyasthmabackgroundbronchitiscarecasualcaucasianchestcoldcoughcoughingdiagnosisdiseaseemphysemafemalefeverfluhealthillillnessinfectioninfluenzaisolatedlungsmaturemedicalmedicinemouthpainpandemicpatientpersonpneumoniaportraitproblemsicksicknesssufferingsymptomthroattreatmentunhealthyviruswhitewoman
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Transform your projects with creative imagery collections
Enhance your creative work with a huge collection of stock images that more than stand out from the crowd. There are a number of thematic categories, depending on whether you are looking for ordinary, everyday lifestyle pictures or something a little more different and unique. Regularly updated to stay current and relevant, our engaging image collections showcase modern and trending photos, including interior designs, happy families, holidays, fresh foods, and more; only the best visuals are selected and made available on the platform. With this high-quality photo stock, every picture can transform uninspiring and plain creatives to compelling visual stories.
Learn our latest tips and tricks for your stock photos on our blog
Our royalty-free stock photo platform is the ultimate source for all your visual needs. Find an endless flow of daily new content updates, ensuring your brand is always looking its best. Users can pay a visit to our free gallery that highlights various images over a hundred pages from everyday occurrences to one-off exceptional events and activities. Looking to make the most out of your new pictures? Be inspired by our blog, which will provide top tips on how your images can benefit your company or project work. We consistently raise the bar, so expect the unexpected when you choose us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.