![Woman holding takeaway paper coffee cup on white background Photo of Woman holding takeaway paper coffee cup on white background](https://static.africaimages.com/photos/1/H/1HZcUJIMC7n6K8csMxwS6c7et/1HZcUJIMC7n6K8csMxwS6c7et_normal.jpg)
Woman holding takeaway paper coffee cup on white background
Stock Photo ID: 296951
Large 4412 × 3796 px, JPG 155.65 × 133.91 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Woman holding takeaway paper coffee cup on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4412 × 3796 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 9 Oct 2018
You may use our image “Woman holding takeaway paper coffee cup on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticawaybackgroundbeveragebrandingbreakbreakfastcafecappuccinocardboardcartonclosedcloseupcoffecoffeecontainercupdeliciousdesigndisposabledrinkenergyespressofemalefreshgreenhandholdinghotisolatedlattelidmockupmorningpackagingpaperpersonplasticrefreshingtaketakeawaytakeouttastytemplatethermotogowaxwhitewoman
Africa Images: the ultimate destination for royalty-free stock photos
Africa Images produces high-quality stock imagery designed to enhance your marketing and advertising endeavors. A detailed process is followed by our expert team before any image is posted on our website, including researching trending and popular materials. Our team of professionals arranges everything you can see in our high-resolution photos, including furniture, food, and technology. With a varied collection covering everything from Christmas to pregnancy and transportation, as well as a range of sizes and resolutions available, there’s a suitable image for all requirements. We offer cost-effective and royalty-free stock photography that will make your brand stand out from the crowd.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
Experience the latest free photos and added-value extras
Our modern online photo stock will impress you and your audience. Indulge in a daily update of the latest visual content and find an assortment of images that can only be found on our platform. Our complimentary gallery is home to over 100 pages of free pictures, across a wide range of themes, including happy families, packaging, and medical instruments, to name just a few. Read our blog posts for valuable advice and tips on how adding our stock photos to your work can boost the recall and interaction. These added value extras to our service are invaluable for marketers, designers, teachers, and anyone looking to enhance their projects.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.