Woman holding takeaway paper coffee cup on white background
Stock Photo ID: 287502
Large 4406 × 3240 px, JPG 155.43 × 114.3 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Woman holding takeaway paper coffee cup on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4406 × 3240 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 9 Oct 2018
You may use our image “Woman holding takeaway paper coffee cup on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticawaybackgroundbeverageblackbrandingbreakbreakfastcafecappuccinocardboardcartonclosedcloseupcoffecoffeecontainercupdeliciousdesigndisposabledrinkenergyespressofemalefreshhandholdinghotisolatedlattelidmockupmorningpackagingpaperpersonplasticrefreshingtaketakeawaytakeouttastytemplatethermotogowaxwhitewoman
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Discover diverse image categories for every creative need
We have developed an impressive collection of stock photo categories that cover aspects of people’s everyday lives up to niche ideas and events to help you keep track of visual trends. By providing exceptional curated images that inspire and spark a positive response from your audience, we reflect the quality standard we observe. Our user-friendly filters and keyword functions can be used on our search page to further refine your results. Discover different aspects of popular home interiors, salons, birthday celebrations, drinks, and other themes that reflect the changes in modern visuals. Make use of these vast photo collections to upgrade your projects and add a touch of style to your brand story in the form of imagery.
Learn our latest tips and tricks for your stock photos on our blog
Our royalty-free stock photo platform is the ultimate source for all your visual needs. Find an endless flow of daily new content updates, ensuring your brand is always looking its best. Users can pay a visit to our free gallery that highlights various images over a hundred pages from everyday occurrences to one-off exceptional events and activities. Looking to make the most out of your new pictures? Be inspired by our blog, which will provide top tips on how your images can benefit your company or project work. We consistently raise the bar, so expect the unexpected when you choose us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get better value for money with our affordable pricing plans
Purchasing high-resolution stock images should be easy to find, purchase, and download from an online supplier. That’s why we have budget-friendly on-demand Standard and Extended license packages that offer great value for money and bulk savings. Our Standard pack allows for our content to be used in digital and print reproductions, as well as outdoor advertising and personal non-commercial use. With Extended, you get all this and more with the ability to use our striking visuals in business or commercial designs, digital templates for sale and distribution, and products that are for sale or distribution.