Woman holding pot with fresh rosemary, closeup
Stock Photo ID: 220703
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Woman holding pot with fresh rosemary, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 10 Jul 2018
You may use our image “Woman holding pot with fresh rosemary, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aromaaromaticbackgroundbotanicalbotanybushcloseupcondimentcookingculinarycultivationdecorfemaleflavorfoodfreshgardengreengrowthhandshealthyherbholdinghomeindoorsingredientkitchenleafnaturalnatureorganicpersonplantpotpottedrawreciperosemaryscentseasonseasoningspicesprigspringtastyvegetarianvitaminwoman
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
The purchasing experience on our stock image platform is a standout
To keep customers happy in a competitive marketplace, we understand that their online experience must be seamless. This is why we have an intuitive website, designed and tailored to meet our users’ specific needs. From start to finish, the process of finding, purchasing, and downloading your chosen images is simple regardless of whether you’re coming to the site with an exact image in mind or with a creative idea to explore in more detail. Our handy license comparison summary will help you understand which type of on-demand pack you require (Standard or Extended) based on the image use and agreement terms.