Woman having online meeting with her colleague via laptop, closeup
Stock Photo ID: 142196
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Woman having online meeting with her colleague via laptop, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 18 May 2020
You may use our image “Woman having online meeting with her colleague via laptop, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbusinesscallcaucasianchatcloseupcolleaguecommunicationcomputerconferencecorporatedevicedigitaldiscussiondisplayfemalehandshappyhavinghomeillustrationindoorsinternetlaptopmalemanmeetingmodernnetworkofficeonlinepeopleremotescreensmartstrategytableteamteamworktechnologyusingvideovideocallvirtualwebwomanworkworkplaceworkspace
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Uncover visual aspiration across categories for your business
Explore a world of visual inspiration using our wide range of stock image categories tailored for various interests and industries. In fact, trending themes like interiors, birthday celebrations, lifestyle, fresh foods, and drinks, among others, are the most popular, making us a modern, innovative, and in demand photo stock. We can provide reassurance that our process of curation means that our photos are visually appealing as well as tell a compelling narrative. Our curated collections showcase the latest trends where each category has its personal tale ready to upgrade your creative endeavors. Simply browse the categories, download, and start using your new images immediately.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Business owners love our photo stock for the purchasing experience
We are a trusted supplier of stock images because we offer our users an efficient and enjoyable experience when using our platform. This, combined with payment protection and cost-effective pricing plans, means that you get a full suite of features and benefits that you likely won’t find with other providers. From browsing to selecting, purchasing, downloading, and using your new images, it only takes a matter of minutes from start to finish. Review our license comparison summary for what is allowed and included with each package so you know whether our Standard or Extended options are best for your creative requirements.