Woman cutting ripe spaghetti squash on table in kitchen, closeup
Stock Photo ID: 286202
Large 6582 × 4310 px, JPG 232.2 × 152.05 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Woman cutting ripe spaghetti squash on table in kitchen, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6582 × 4310 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 22 Oct 2018
You may use our image “Woman cutting ripe spaghetti squash on table in kitchen, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundboardcloseupcookingcourgettecucurbitculinarycuttingdeliciousdieteatfemalefoodfreshgourdgourmethandshealthierhealthyindoorsingredientkitchenknifemarblemicrowavenaturalnutritionorganicpastapersonpumpkinrawreciperecipesripespaghettisquashtabletastyuncookedveganvegetablevegetarianvitaminwholewomanyellow
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Download inspiring visuals from our extensive image collections
Explore the creativity behind the selection process for our diverse stock photo categories. From the everyday existence images through to one-off events and celebrations, you will also find popular and trending themed collections including aspirational interior design, soothing spas, wanderlust holidays and travel, healthy fresh foods, and so much more. These varied categories are regularly reviewed and updated by our team, ensuring they are current, inspiring and keep your brand efforts fresh and effective. Every single picture is a carefully crafted and styled work of art, expertly selected for your satisfaction above and beyond the expectation of a photo stock.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Do more with less, thanks to our cost-effective pricing options
With so much choice on offer online when it comes to stock images, finding a provider who not only has the best quality and most diverse range of pictures available but also makes the user experience simple yet effective from start to finish can be difficult. Not with our photo stock. Our Standard and Extended on-demand pricing packs give you options when it comes to the number of images per download, with cost savings available for the more you buy. The more photos you download, the more creative you can be in your projects. Take advantage of our platform today.