
Winemaking. Composition with tasty wine and wooden barrel on gray table, above view. Space for text
Stock Photo ID: 1507613
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Winemaking. Composition with tasty wine and wooden barrel on gray table, above view. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 24 Oct 2023
You may use our image “Winemaking. Composition with tasty wine and wooden barrel on gray table, above view. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
abovealcoholbackgroundbarbarrelbeverageblackbordeauxbottlecabernetcaskcelebrationcheesecompositioncontainercopycorkcorkscrewdeliciousdrinkexpensivefoodfruitglassgourmetgrapesgraykegliquidluxurymerlotobjectoenologyoldredslatespacestoragetabletastytexttopviewvintagewinewineglasswinemakingwinerywoodwooden
Africa Images: stay relevant and up to date with the latest trends
At Africa Images, we pride ourselves on offering content creators the latest and most unique stock photos and visual services. Our daily updated image collections, which include trending and popular materials, are ideal for both commercial and non-commercial projects. If you are in marketing, advertising, or communications, these royalty-free pictures can improve your campaigns by raising brand awareness and driving sales. By monitoring and staying up to date with the latest trends, and offering a range of sizes and resolutions, we guarantee that with our distinct images, your company will stand out from its competitors and leave a lasting impression on your audience.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Bring imagination to life with our impressive image collections
We have a wealth of stock images available in our ample choice of categories. Whether you are looking for visuals that highlight everyday life or are seeking trending images that include the latest interior designs, home décor, salons, and spas, we have a suitable picture in one of our collections. Every one of these images is carefully selected, which demonstrates our dedication to excellence in quality. These collections are updated on a regular basis so that there is no danger of your business falling behind the competition. Stimulate your mind by browsing our expertly curated selection of stock photos that have their own stories and will help take your work to the next level.
We offer the latest images plus helpful blog content and much more
Experience a world of exceptional photography with the ultimate photo stock. Get your designs looking modern and trendy with daily updated collections and a range of unique pictures that cannot be found on any other platform. Get inspired with our large free gallery full of diverse images and with filter options to help you source the ideal picture or illustration. Our blog provides content creators with all you need to know about how to make use of your new stock images, from styling tips to color psychology in marketing and promotional ideas. We have got you covered. This approach sets us apart from our competitors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.