![White pills on light blue background, above view Photo of White pills on light blue background, above view](https://static.africaimages.com/photos/E/S/ESA0T5GUfJMLhnFQEEHlePKIv/ESA0T5GUfJMLhnFQEEHlePKIv_normal.jpg)
White pills on light blue background, above view
Stock Photo ID: 1380447
Large 4480 × 6720 px, JPG 158.04 × 237.07 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “White pills on light blue background, above view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4480 × 6720 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 29 Jun 2023
You may use our image “White pills on light blue background, above view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aboveaidantibioticbackgroundbluecarechemicalcurediseasedoctordosedruggrouphealhealthhealthcarehelpilllightmanymedicalmedicamentmedicationmedicinalmedicinemedsobjectpainpainkillerpatternpharmaceuticalpharmacypillpillsprescriptionrecoveryreliefremedyservicesicksicknesssupplementtablettexturetherapytreatmentverticalviewvitaminwhite
Discover the latest and best-trending stock photos at Africa Images
Africa Studio — your home of exceptional pictures — brings you Africa Images, a handpicked selection of high-resolution stock photos compiled by our top photographers and creators. We offer a range of different sizes and resolutions so that you can find the perfect image for your projects. Our dedicated team constantly tracks recent trends and popular materials and updates our photo collections daily with the latest images. Our visuals will make your creative ideas come to life and help you have an unforgettable and engaging marketing campaign. Use our royalty-free images to increase your brand’s visibility and raise product demand.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Do more with less, thanks to our cost-effective pricing options
With so much choice on offer online when it comes to stock images, finding a provider who not only has the best quality and most diverse range of pictures available but also makes the user experience simple yet effective from start to finish can be difficult. Not with our photo stock. Our Standard and Extended on-demand pricing packs give you options when it comes to the number of images per download, with cost savings available for the more you buy. The more photos you download, the more creative you can be in your projects. Take advantage of our platform today.