
Wet radish in colander on white table, closeup
Stock Photo ID: 1765502
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Wet radish in colander on white table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 16 Apr 2024
You may use our image “Wet radish in colander on white table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundboardcleancleaningcloseupcolandercookwaredietdietingdomesticeatequipmentfoodfreshgreenhandlehealthyholehouseholdhygienekitchenkitchenwareleavesmetalmetallicnaturalnobodynutritionobjectorganicpreparationprepareproductradishrawripeseparationshinysievestrainersummertabletoolutensilvegetablevegetarianvitaminwashwetwhite
Africa Images: your destination for creative visuals
Africa Images, owned by Africa Studio, is dedicated to offering the newest and widest range of high-quality stock pictures. With all types and subcategories of images, such as hygiene products and interiors, it is easy to find what you are looking for in our vast photo collections. Our “Featured collections” gallery is home to the latest trending and popular photos and is an excellent source of inspiration for your advertising and marketing campaigns. Content creators and business owners can not only boost their sales, but also increase their visibility in the market thanks to the bonus features and benefits on offer, including free images, previews, and unlimited downloads.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.