
Top view of woman holding smartphone over white wooden table with lunchboxes, mockup for design. Healthy food delivery
Stock Photo ID: 516753
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Top view of woman holding smartphone over white wooden table with lunchboxes, mockup for design. Healthy food delivery”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 30 Aug 2019
You may use our image “Top view of woman holding smartphone over white wooden table with lunchboxes, mockup for design. Healthy food delivery” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundboxcarbcleancloseupcontainercookingcopydeliverydesigneatfemaleflatfoodgourmethandshealthyholdingingredientlaptoplaylifestylelunchlunchboxesmealmeatmobilemockupnutritionorderorganicpersonphonereciperestaurantsaladservicesmartphonespacetabletakeawaytakeouttechnologytexttopvegetableviewwhitewomanwooden
Africa Images: where quality and creativity come together in harmony
Our purpose at Africa Images is to provide our customers with the highest quality, royalty-free stock photos that will increase brand recognition and credibility. With a wide range of photography categories in our expansive collection, such as pests, religion, and gardening, we have images suitable for any project — whether it is commercial or non-commercial. Our pictures are available in different dimensions and resolutions so that they meet your creative requirements. To enhance and expand our services for content creators, we have included additional features and benefits, including unlimited downloads, free photos, and previews. The “Featured collections” gallery has endless inspiration for web designers, marketers, business owners, bloggers, and advertisers looking for trending and popular content.
Discover the transformative power of stock pictures for your campaigns
Pictures can alter how stories are told, brands are marketed, and communication is conducted in a world where conventional spaces blend with an ever-increasing digital presence. These aspects can surpass language barriers, stimulate feelings and emotions, and provide the highest engagement level. With a purchase of our licensed high-resolution stock photos, you can take confidence and pride in the fact that your creative integrity is protected along with that of the image creator. Discover our ever-evolving and growing stock photo resource for royalty-free visuals where each image is a storyteller, creating a lasting and memorable impression.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Get diverse pictures and extra advantages with our photo stock
Explore stock images and much more on our popular platform. Daily content updates mean you can benefit from the latest pictures, with a selection that is unique to this site alone. Feel free to explore the large variety of free images in our gallery that covers in-demand topics like pets, holidays, cooking, and nature. Whether you are looking for a specific image or just for inspiration, there will be a suitable image available to satisfy your creative requirements. Additionally, we have a blog that gives useful tips on how to utilize your newly downloaded stock photos in advertising campaigns or marketing products for both commercial and non-commercial organizations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a positive buying experience from start to finish
It doesn’t have to be difficult to find quality stock images online. We certainly don’t make it so with our user-friendly website and service offering. Users can select from Standard or Extended license on-demand pricing packs that reduce the price per individual image with the more you buy in bulk. You can compare the two license types to determine which one is needed based on your proposed image use. Some noteworthy differences of the Extended pack are that you will be allowed to use our content on products for sale or distribution, on digital templates for sale or distribution, and on any designs for business or commercial space.