![Technical support operator with headset in modern office Photo of Technical support operator with headset in modern office](https://static.africaimages.com/photos/1/G/1GjXSjUoZCRjV0im7fJYkbiHN/1GjXSjUoZCRjV0im7fJYkbiHN_normal.jpg)
Technical support operator with headset in modern office
Stock Photo ID: 378021
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Technical support operator with headset in modern office”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 20 Jan 2019
You may use our image “Technical support operator with headset in modern office” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultbackgroundbusinesscallcaucasiancenterclientcommunicationcomputercontactcorporatecustomerdeskemployeefemalefriendlyheadsethelphelpdeskhelplinehotlineindoorslaptoplinemalemanmodernofficeonlineoperatorpeoplephoneportraitprofessionalreceptionistrepresentativeservicesupportteamtechnicaltechnologytelecomtelemarketingtelephonewomanworkworkplaceyoung
Africa Images: the ultimate destination for royalty-free stock photos
Africa Images produces high-quality stock imagery designed to enhance your marketing and advertising endeavors. A detailed process is followed by our expert team before any image is posted on our website, including researching trending and popular materials. Our team of professionals arranges everything you can see in our high-resolution photos, including furniture, food, and technology. With a varied collection covering everything from Christmas to pregnancy and transportation, as well as a range of sizes and resolutions available, there’s a suitable image for all requirements. We offer cost-effective and royalty-free stock photography that will make your brand stand out from the crowd.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Learn our latest tips and tricks for your stock photos on our blog
Our royalty-free stock photo platform is the ultimate source for all your visual needs. Find an endless flow of daily new content updates, ensuring your brand is always looking its best. Users can pay a visit to our free gallery that highlights various images over a hundred pages from everyday occurrences to one-off exceptional events and activities. Looking to make the most out of your new pictures? Be inspired by our blog, which will provide top tips on how your images can benefit your company or project work. We consistently raise the bar, so expect the unexpected when you choose us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.