
Team of technical support with headsets at workplace
Stock Photo ID: 371392
Large 5590 × 3726 px, JPG 197.2 × 131.44 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Team of technical support with headsets at workplace”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5590 × 3726 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 16 Dec 2018
You may use our image “Team of technical support with headsets at workplace” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultafrican-americanafroagentbackgroundbusinesscallcaucasiancentercommunicationcomputercontactcustomerdeviceemployeeequipmentfemalefriendlyhappyheadsetshelphelpdeskhelplinehotlineindoorsinternetmodernofficeonlineoperatorpeoplephoneportraitprofessionalreceptionistrepresentativeservicesmilingsupporttableteamtechnicaltechnologytelecomtelephonewomanworkworkplaceyoung
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
Craft strong narratives with stock photos for visual storytelling
In the vast marketing and communications landscape, images can help to build brands, shape compelling narratives, and enhance creativity. They can say a thousand words without saying any words at all. Whether they are used on their own or to enhance content, imagery helps to elicit emotion, increase information retention, and make sense of complex situations. They can change the way an audience thinks, feels, and acts. With our extensive royalty-free images, content creators and business owners can push boundaries and craft memorable and inspiring dialogues, long remaining and capturing the hearts and minds of audiences. Find your brand’s visual narrative today.
Craft excellence with a wide variety of stock photo categories
Explore our extensive collection of image categories that depict the intricacies of everyday life as well as more specialist subjects. In line with this commitment to our customers, we regularly update our collections and focus on presenting only high-quality photos and trending topics such as traveling, home décor, salons, spas, holidays, business, and more. Immerse yourself in collections that challenge existing standards of excellence in the stock photo industry. Each set of images represents an acknowledgment of this dedication to quality and ensures you get royalty-free images which will result in a new and enhanced look for your brand.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Save your precious funds with our stock image pricing bundles
From browsing our vast image collections to selecting, purchasing, and downloading, we make the process effortless for our valued customers. We understand that business owners and independent freelancers all want to save money where they can, which is why our affordable pricing plans offer greater value for money the more you buy. With our license comparison information, you can easily determine which on-demand pack you require for your commercial or non-commercial activities. All our content terms and conditions can also be helpfully found within our license agreement page for complete clarity and peace of mind when downloading from our site.