Tasty yogurt in glass and berries on white marble table, flat lay. Space for text
Stock Photo ID: 1732907
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Tasty yogurt in glass and berries on white marble table, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 28 Mar 2024
You may use our image “Tasty yogurt in glass and berries on white marble table, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
antioxidantbackgroundberriesbeveragebiobreakfastcarecocktailcoldcopycreamdairydessertdietdrinkeatflatfoodfreshglasshealthyhomemadekefirlayliquidmarblemealmilkmorningnaturalnutritionobjectorganicproductproteinrefreshmentspacestrawberrysummersweettabletastytexttopvegetarianviewvitaminwhiteyoghurtyogurt
Africa Images: perfect photos for all your business and project needs
Africa Images is a leading high-quality stock photography provider. We change our collections every day by keeping track of trends and making sure current images are of interest to our valued customers. With a team of professionals, including designers, retouchers, and models working on photo shoots, attention is paid to every detail of the image down to the furniture, technology, and food shown. High-resolution images are extremely important for your marketing, advertising, business ventures or other commercial activities to convey a professional and credible reputation. Our royalty-free stock images will help you develop a positive corporate image, leading to increased sales.
Uncover the reflective power of stock photos for your business
High-resolution stock photos can provide a winning formula for developing an impactful marketing or advertising campaign, resulting in long-lasting impact and results for your business. High-quality stock images create a sense of emotion that will inspire users to connect with your content. These varied images serve as a useful resource for content creators who are interested in understanding how their target audience or readers will emotionally respond so that they can select the best and most appropriate pictures. Our royalty-free images will help make a deeper connection and create a greater impression on your audience for more effective engagement.
Find the best modern royalty-free image collections here
Use our imaginative stock image collections for inspiration and tell powerful stories. With regularly updated collections and millions of available images to browse and download, you will easily discover your perfect visuals. Discover the latest trending pictures showcasing the opulence of home interiors, the magnetism of a spa, laidback holiday vibes, and the fast-paced world of business. When clicking on your desired category, you will find the photo collections grouped by the same subject. Need to refine your search? Use our search page with the help of convenient filters and keywords. Delve into thoughtfully crafted collections that extend beyond aesthetics, sparking imagination for your campaigns.
Encounter a world of special imagery with our popular photo stock
Your visuals will always be cutting-edge with our fast-moving online photo stock. Relish fresh and original content accompanied by a free image gallery with over 100 pages covering different themes and topics, including sports, cosmetics, food, fashion, and much more. Take a read of our inspiring blog posts, where we offer handy hints and tips that can be used in business and creative campaigns to boost the power of stock images. So, if you are looking for high-quality images to enhance either your commercial or non-commercial projects, along with added benefits and service features, you have come to the right place.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.