![Tasty toast with raspberry jam and fresh berries for breakfast on turquoise table, flat lay Image of Tasty toast with raspberry jam and fresh berries for breakfast on turquoise table, flat lay](https://static.africaimages.com/photos/g/F/gFoeVinUWJuiesncRQxM2OYwF/gFoeVinUWJuiesncRQxM2OYwF_normal.jpg)
Tasty toast with raspberry jam and fresh berries for breakfast on turquoise table, flat lay
Stock Photo ID: 163190
Large 6588 × 4392 px, JPG 232.41 × 154.94 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Tasty toast with raspberry jam and fresh berries for breakfast on turquoise table, flat lay”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6588 × 4392 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 25 Aug 2020
You may use our image “Tasty toast with raspberry jam and fresh berries for breakfast on turquoise table, flat lay” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundberriesberrybreadbreakfastconfiturecookingcrunchydeliciousdesserteatflatfoodfreshfruitgelatingourmethealthyhomemadeingredientjamjarjellykitchenknifelaymarmaladenaturalnutritionobjectorganicplatepreserveraspberryredsandwichservedslicesnackspacesummersweettabletastytoasttopturquoiseviewwoodenyummy
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
Experience the latest free photos and added-value extras
Our modern online photo stock will impress you and your audience. Indulge in a daily update of the latest visual content and find an assortment of images that can only be found on our platform. Our complimentary gallery is home to over 100 pages of free pictures, across a wide range of themes, including happy families, packaging, and medical instruments, to name just a few. Read our blog posts for valuable advice and tips on how adding our stock photos to your work can boost the recall and interaction. These added value extras to our service are invaluable for marketers, designers, teachers, and anyone looking to enhance their projects.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.