Tasty chocolate halva as background, closeup view
Stock Photo ID: 1531357
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Tasty chocolate halva as background, closeup view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 14 Dec 2023
You may use our image “Tasty chocolate halva as background, closeup view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
arabicbackdropbackgroundcaloriechocolatecloseupcocoaconfectionconfectionerycookcuisinecutdeliciousdesserteasteasternfatfoodgourmetgreekhalavahalavahhalawahalvahalvahhealthyhelvahomemadehoneynutritionobjectorientalportionrecipesnacksugarsugarysweettastetastytexturetoptraditionaltreatturkeyturkishvegetarianviewwallpaperyummy
Africa Images: your destination for creative visuals
Africa Images, owned by Africa Studio, is dedicated to offering the newest and widest range of high-quality stock pictures. With all types and subcategories of images, such as hygiene products and interiors, it is easy to find what you are looking for in our vast photo collections. Our “Featured collections” gallery is home to the latest trending and popular photos and is an excellent source of inspiration for your advertising and marketing campaigns. Content creators and business owners can not only boost their sales, but also increase their visibility in the market thanks to the bonus features and benefits on offer, including free images, previews, and unlimited downloads.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Help your brand standout with a wide range of image categories
Our expertly curated photo stock collections ensure you get a highly visual experience that speaks volumes about style and excellence. With categories dedicated to everyday scenes as well as more specialist subjects, we regularly update our collections, so they reflect the latest trends and popular materials, including stunning home decor, sleek salons, and spas, as well as appetizing scenes for fresh food and drinks. Think of a theme or have an image idea for your next project, and we will likely have it on our website. Simply browse our extensive collections for inspiration and that perfect picture before downloading and using your photos.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.