Shrimp cocktail with tomato sauce on wooden table. Space for text
Stock Photo ID: 91601
Large 5668 × 3778 px, JPG 199.95 × 133.28 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Shrimp cocktail with tomato sauce on wooden table. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5668 × 3778 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 9 Dec 2019
You may use our image “Shrimp cocktail with tomato sauce on wooden table. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
appetizerbackgroundcloseupcocktailcolorcookcookingcopycrustaceancuisineculinarydelicacydeliciousdietdinnereatfoodfreshgastronomyglassgourmethealthyingredientkitchenlunchluxurymealnaturalnutritionobjectorganicprawnreciperedrestaurantrosemarysauceseaseafoodservedshellfishshrimpsnackspacetabletastytexttomatowooden
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
High-quality stock photos can be transformative across industries
High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.
Uncover visual aspiration across categories for your business
Explore a world of visual inspiration using our wide range of stock image categories tailored for various interests and industries. In fact, trending themes like interiors, birthday celebrations, lifestyle, fresh foods, and drinks, among others, are the most popular, making us a modern, innovative, and in demand photo stock. We can provide reassurance that our process of curation means that our photos are visually appealing as well as tell a compelling narrative. Our curated collections showcase the latest trends where each category has its personal tale ready to upgrade your creative endeavors. Simply browse the categories, download, and start using your new images immediately.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.