Shelves of empty modern refrigerator, closeup view
Stock Photo ID: 125760
Large 3840 × 5760 px, JPG 135.47 × 203.2 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Shelves of empty modern refrigerator, closeup view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 3840 × 5760 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 22 Nov 2019
You may use our image “Shelves of empty modern refrigerator, closeup view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
appliancebackgroundcapacitorcleancloseupcoldcondensercontainercontrolcoolcoolerdevicedomesticdrawerselectricelectricalemptyequipmentfoodfreezefreezerfreshfreshnessfridgefrosthomehouseholdinsidekeepingkitchenlifestylemachinemodernnewobjectopenpantryrefrigeratorshelfshelvessteelstoragestylestylishtechtechnologytemperatureview
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.