Scoop and pile of chocolate protein powder isolated on white, top view
Stock Photo ID: 466948
Large 5495 × 4462 px, JPG 193.85 × 157.41 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Scoop and pile of chocolate protein powder isolated on white, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5495 × 4462 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 10 Apr 2019
You may use our image “Scoop and pile of chocolate protein powder isolated on white, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbeveragebodybuildingbreakfastbrowncarechocolatecocktailcocoadeliciousdietdrinkenergyexercisingfitnessflatfoodfreshgainergymhealthyheapingredientisolatedlaylifestylelossmealmusclenaturalnutrientnutritionobjectorganicpilepowderproteinscoopshakesportsupplementtoptrainingviewvitaminweightwheywhiteworkout
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Revitalize your visual content with the latest stock images
Your go-to online photo stock provides the perfect place for you to immerse yourself in creativity. Enjoy a constant flow of fresh content, including a collection of unique photos not available elsewhere. We also have a huge free image gallery covering an array of topics whereas our blog gives you invaluable ideas, tactics, and techniques on how to use stock imagery for business and creative growth. These additional benefits and features of our service make us a popular choice for content creators and business owners alike to upgrade both commercial and non-commercial projects. Reap the rewards of using our site today and enjoy amazing new content for your campaigns.
Benefit from payment protection, customer service, and more with us
Our respected photo stock platform will provide users with peace of mind when it comes to their personal data and secure payments, as well as the latest trending visuals. Our easy-to-navigate interface makes it quicker than ever for you to find and download pictures. This commitment to excellence extends to our customer support service, which answers your questions promptly and sufficiently. When it comes to our platform, it’s not just about the quality of pictures but the complete package, including credibility, reliability, and user convenience. For those looking for a reputable online photo supplier, choose us — we are where confidence meets convenience, and satisfaction always comes first.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.