
Romantic young couple with tea in spa salon
Stock Photo ID: 417916
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Romantic young couple with tea in spa salon”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 27 Feb 2019
You may use our image “Romantic young couple with tea in spa salon” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultarmchairsaromatherapybackgroundbathrobesbeautybodycarecaucasiancenterclientcosmeticcouplecupdrinkdrinkingfemalehappyhealthholidayhoneymoonhotelindoorslifestyleloveluxurymalemanmassagemedicalorientalpeopleportraitprofessionalrelaxresortrestromanticsalonsittingskinsmilingspateatherapytreatmentwellnesswhitewomanyoung
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Create magic with our expansive stock photography collections
Our varied range of image categories — from everyday scenes to highly specialized subjects — will keep you up to date with the latest visual and popular trends. With millions of images available on the platform, we are dedicated to offering the best possible royalty-free photos that meet the highest standards. In our regularly updated collections, you will see nothing but exceptional, beautiful pictures. Examine new trends in home interiors, salons, spas, businesses, and drinks, whose every category highlights the evolving landscape of visual storytelling. From A to Z, you will easily find the right images that reflect your brand vision and enhance your projects.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.