Ripe physalis fruits with calyxes in bowl on white table, closeup
Stock Photo ID: 1564185
Large 4480 × 6720 px, JPG 158.04 × 237.07 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Ripe physalis fruits with calyxes in bowl on white table, closeup”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4480 × 6720 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 27 Dec 2023
You may use our image “Ripe physalis fruits with calyxes in bowl on white table, closeup” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
autumnbackgroundberrybowlcalyxescapecloseupdeliciousdessertdieteatingedibleexoticfoodfreshfruitsgooseberrygourmetgroupharvesthealthhealthyhuskingredientmanynaturalnutritionobjectorangeorganicperuvianaphysalisproductrawripeseasonseasonalsummersweettabletastytropicalveganvegetarianverticalvitaminwhiteyellow
Create visual excellence with Africa Images’ royalty-free photography
For content creators looking for high-resolution stock photos to enhance their creative projects, you’ve come to the right place. With our varied photo collections and illustrations that cover everything from happy families to drinks and pests, we can help your brand stand out. At our photo shoots, every single detail you see if carefully considered and styled, including any furniture, food, and technology. Our expert team of photographers, stylists, models, and re-touchers ensure the final product is of the highest quality before it is uploaded to our website. Along with daily updated collections, our additional benefits, such as preview sharing, free images, and unlimited downloads, mean that our cost-effective service will give you plenty of opportunities to increase the appeal and effectiveness of your campaigns.
Discover how pictures can drive brand engagement and loyalty
When done professionally and with purpose, images can drive significant engagement and brand recognition for your business. The lasting presence of an image can enhance a piece of content’s reach while also keeping it alive in the reader’s mind. Investing in high-quality, royalty-free images could be different between potential customers choosing your brand over competitors. If you want your campaign or next piece of content to drive maximum impact and be faster and more effective, our photo stock will enable you to create impressive visual strategies. You can trust in our professional photography to enhance your advertisement campaigns or promotions.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Do more with less, thanks to our cost-effective pricing options
With so much choice on offer online when it comes to stock images, finding a provider who not only has the best quality and most diverse range of pictures available but also makes the user experience simple yet effective from start to finish can be difficult. Not with our photo stock. Our Standard and Extended on-demand pricing packs give you options when it comes to the number of images per download, with cost savings available for the more you buy. The more photos you download, the more creative you can be in your projects. Take advantage of our platform today.