Red wine and snacks served for picnic on white wooden table outdoors
Stock Photo ID: 509952
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Red wine and snacks served for picnic on white wooden table outdoors”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 23 Aug 2019
You may use our image “Red wine and snacks served for picnic on white wooden table outdoors” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
alcoholbackgroundbarbeverageburgundycabernetcelebrationcheesedrinkfoodfruitgardenglassgourmetgrapegrapesgreenlifestyleliquidlunchluxurymealmerlotmozzarellanaturenutsobjectoldoutdoorsparkpartypicnicplatequalityredrestaurantromanticseasonservedsnacksspringsummertablevineyardwhitewinewineglasswinerywooden
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Find diverse stock image collections to elevate your work
Regardless of what industry you are in, our platform has diverse images that cover all kinds of everyday activities and even specialist subjects. Explore the hottest topics and trending themes in popular categories including interiors, home decor, salons, spas, food, drinks, and much more. When you browse on a selected category, you will find photo collections grouped by the same theme. With our convenient filters and keyword functionality, you can refine your results using our search page. We guarantee you will find the perfect picture in one of our quality collections that matches with your idea or specific campaign.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
We offer flexible pricing plans to help you craft visual excellence
When it comes to finding not only the best quality but affordable images, we are the photo stock of choice. We offer cost-effective on-demand pricing plans that don't break the bank. Priced from only $5 per high-resolution image on our Standard license and a bulk saving when you purchase 10 images for $25, this will give you the opportunity to save in the long run and have more photos available when you need them for your upcoming campaigns. From browsing our collections for your desired pictures to purchasing and downloading them, we have made the process as smooth and as enjoyable as possible for the ultimate buyer experience.