
Real estate agent giving house key to couple indoors
Stock Photo ID: 760504
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model release for this stock photo is signed with Africa Studio.
What is an image “Real estate agent giving house key to couple indoors”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 15 Jun 2021
You may use our image “Real estate agent giving house key to couple indoors” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
achievementadultagentapartmentbackgroundbusinessbuyerscaucasiancouplecustomerdecisiondreamestateexchangefamilyfemalegivinghappyholdinghomehousehusbandindoorsjoykeyloanloveluxurymalemanmortgagenewownerownershippaidpeoplepropertyrealrelationshiprelocationrentalrentersellsmilingsuccesstogethervisitwifewomanyoung
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
High-quality stock photos can be transformative across industries
High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
An inspirational photo stock that goes beyond just images
Use a modern and impactful online photo stock that adds power to your visual storytelling. With new content added every day, you can find a selection of diverse and unique pictures only available on this platform. Explore our gallery, which is completely free and has subjects like home decor and business among the popular and current image trends. Our inspiring blog posts contain information, tips, and ideas for using stock photos in your business and extra-curricular activities. We offer the full package that will improve your brand’s creative output and appeal, while other image providers can only provide part of the overall experience.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
An amazing buying experience is what makes us a top photo stock
In today’s evolving and fast-paced business world, you need an image supplier who can give you the full user experience when it comes to sourcing, purchasing, and downloading the best quality stock photographs. That provider is us. We understand that time is money, so we designed our site with our users in mind for speedier and stress-free browsing navigation. Our on-demand pricing plans ensure value for money, particularly when it comes to buying in bulk. If you’re unsure which license is right for you, our helpful comparison data highlights the differences between our Standard and Extended plans so you can determine exactly what you need depending on how you plan to use your images.