![Raw horns pasta as background, top view Photo of Raw horns pasta as background, top view](https://static.africaimages.com/photos/m/b/mbyvSB8jXeV0Qlf5b08faxqA1/mbyvSB8jXeV0Qlf5b08faxqA1_normal.jpg)
Raw horns pasta as background, top view
Stock Photo ID: 1489614
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Raw horns pasta as background, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 17 Nov 2023
You may use our image “Raw horns pasta as background, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backdropbackgroundcloseupcookcookingcuisineculinarydeliciousdietdinnerdishdoughdryeatfoodfreshgastronomygourmetgrouphealthyhornsingredientitalianlunchmacaronimanymealnaturalnobodynutritionobjectorganicpastapileproductrawreciperestaurantshapesorttoptraditionaltypeuncookedveganvegetarianviewwallpaperwheatyellow
Tell a visual story with Africa Images’ high-resolution photo stock
With high-quality stock photos that are updated daily, Africa Images will create a unique market presence for your brand. Our team knows the importance of having a professional business profile to enhance your reputation, and our royalty-free images will help you stand out from the competition. You can easily find animal, insurance, medical, or even finance photos, among others, on our website, which we have designed to be as user-friendly as possible. The dedicated team at Africa Images constantly monitors and tracks emerging trends and popular themes to guarantee that you will always be that one step ahead.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Find out why we are the photo stock of choice for designers
Unlock your brand’s creative potential with our popular and trendy stock photo collections. Our platform users will receive a regular supply of daily updated visuals, which sets our service apart from other image providers. Take advantage of a free gallery featuring more than 100 pages of pictures across various subjects, with helpful filters so you can easily find the image you need. Our blog section is where we share information on the most efficient ways of using stock photos and illustrations in various business or personal projects. The addition of these extra features and benefits is our way of showing our loyal customers how important they are to us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s secure and simple to find your ideal image on our website
Don’t you hate when you waste precious time searching online for stock images only to find the quality, user experience, payment processing, and poor customer service? That’s not the case with our photo stock. Alongside diverse image collections, easy website navigation, and payment protection at checkout, our on-demand pack options provide choices depending on your usage needs and, most importantly, cost savings when buying in bulk. Both the Standard and Extended licenses allow for our visual content to be used in digital reproductions, as well as personal non-commercial use. With Extended, you benefit from unlimited use in printed reproductions and outdoor advertising. You can also use this license type if you’re involved in designing business or commercial spaces, as well as in products for sale or distribution and digital templates for sale or distribution.