Protein shake and powder on wooden table, flat lay. Space for text
Stock Photo ID: 104777
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Protein shake and powder on wooden table, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 12 Dec 2019
You may use our image “Protein shake and powder on wooden table, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
antioxidantbackgroundbeveragebodybodybuildingcaseincocktailcopydeliciousdietdrinkenergyfitnessflatfoodgainerglassgourmethealthhealthyingredientlaylifestylemealmusclenutrientnutritionobjectorganicpowderproductproteinrecipereplacementscoopshakespacesportsupplementtabletastytexttopvanillaviewvitaminwellnesswheywooden
Find visual inspiration for your creative projects at Africa Images
At Africa Images, we understand the importance of a stylish and attractive corporate identity, which is why we only create the highest-quality royalty-free stock photography. In addition to daily updates to our huge image collections and continuous monitoring of trending content and high-demand materials, we also offer additional services such as previews, free images, and unlimited downloads. This is what differentiates us from other stock photo companies. Whether it’s nature-related pictures, tableware, or fresh veggies, there’s an image and a size available on our user-friendly website. You can trust our professional photos to enhance your advertisement campaigns or promotions.
Learn how to navigate ethical stock image use for your brand
In a growing digital landscape, it’s important for businesses to understand the role and need for image licensing, copyright, and ethical practices. For creatives, finding the right picture to use is important, but at Africa Images, we believe it’s equally important to have moral and responsible image standards in place to safeguard both the user and creator. Every available picture you see on the website is made with integrity. It means that you have peace of mind that you have not only a high-quality image but one that respects creators’ rights. Discover the world of copyrighted images responsibly for your brand.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Take advantage of our additional image services and benefits
Let our stock photographs take your business to the highest levels of excellence. Revel in daily updated images, which are available on our searchable and easy-to-navigate website. Browse our free gallery that contains a wide range of subjects from animals to toys and travel. Whatever the campaign theme or creative idea you are working on, we have the perfect image available in this complimentary collection. A read of our useful blog will provide essential advice on how to utilize stock photos in your work. These benefits are just some of the additional ways we reward our loyal customers for using our services.
Our secure website makes us a trustworthy photo stock provider
Our popular photo stock is loved by content creators, marketers, bloggers and students alike for its diverse collections of royalty-free images as well as for implementing security measures that mean worry-free browsing, purchasing, and downloading from our easy-to-navigate site. You can rest assured that your personal data and payment information are securely protected at all times. Unsure where to find exactly what you need? Our helpful customer service support is available to answer all your questions or address any concerns you may have. This is what makes us a standout provider from the competition and is why our customers have trust in our platform.
We make using diverse and trendy images both fun and affordable
Give your budgets a boost when it comes to our on-demand image pricing plans. With one Standard license picture costing just $5, why not plan ahead with a bulk purchase of 10 images for a cost-saving total of $25? For those who need to do more with their downloads, where one image will set you back $65, take advantage of five Extended license pictures for just $295. Not only will this saving help you invest in other areas of your business, but it will also help with content planning for your upcoming campaigns. Browse our user-friendly, inspirational, and inexpensive website for all your stock photo needs.