Plum puree in bowl and fresh fruits on white background, top view
Stock Photo ID: 958829
Large 7170 × 4780 px, JPG 252.94 × 168.63 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Plum puree in bowl and fresh fruits on white background, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 7170 × 4780 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 12 Jul 2022
You may use our image “Plum puree in bowl and fresh fruits on white background, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
babybackgroundbowlcarechildcookedculinarydeliciousdessertdietdisheatfoodfreshfruitfruitsgourmethealthyhomemadeingredientisolatedkidmealnaturalnourishmentnutrientnutritionnutritiousobjectorganicplumplumspureepureedreciperedsauceseasonalsnackstewedsummersweettexturetopveganvegetarianviewvitaminwhiteyummy
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Unravel the importance of ethical licensing with stock photography
When using stock images, you can have professional designs for your website, ads, brochures, and signs without breaking the bank or taking any legal risks. By downloading royalty-free pictures directly from our website, content creators can use them in all the ways accepted by our license agreements, including commercial use such as in marketing materials and more, legally. Whether you are looking for Standard or Extended license stock photography for your blog posts, billboards, social media pages, banners, promotional materials, or some other creative idea, you will find inspiring and engaging high-res images of all kinds at our photo stock.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Learn our latest tips and tricks for your stock photos on our blog
Our royalty-free stock photo platform is the ultimate source for all your visual needs. Find an endless flow of daily new content updates, ensuring your brand is always looking its best. Users can pay a visit to our free gallery that highlights various images over a hundred pages from everyday occurrences to one-off exceptional events and activities. Looking to make the most out of your new pictures? Be inspired by our blog, which will provide top tips on how your images can benefit your company or project work. We consistently raise the bar, so expect the unexpected when you choose us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.