
Plate with delicious spirulina popsicles and lime on grey background, top view. Space for text
Stock Photo ID: 373654
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Plate with delicious spirulina popsicles and lime on grey background, top view. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 29 Jan 2019
You may use our image “Plate with delicious spirulina popsicles and lime on grey background, top view. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
algaebackgroundcoldcookingcopycreamdairydeliciousdessertdetoxeatingfoodfreshfrozengreengreyhealthyhomemadeiceice-creamicecreamingredientlimemilknaturalnutritionobjectorganicplatepopsiclepopsiclespowderreciperefreshmentspacespirulinasummersupersuperfoodsweettabletastytexttoptreatveganvegetarianviewvitaminyogurt
Create stunning visuals with Africa Images’ stock photography
Africa Images, a photo stock agency from Africa Studio, can help you meet your company goals with engaging, royalty-free images. Our team of experts keeps us updated on new trends and popular materials so that whatever may arise, you are always a step ahead. No matter whether your project is commercial or non-commercial, these professionally taken photographs will add that extra bit of quality. Our additional features, such as free photos, picture previews, and unlimited downloads, are all designed to help boost and enhance your creative ventures. Your marketing and advertising will be more effective with our high-resolution images, which will benefit your promotion, campaign performance, and, ultimately, sales.
Learn the importance of responsible image use with our photo stock
Stock photos refer to pictures or illustrations that have been licensed for commercial or non-commercial use. Marketing departments, website developers, or graphic designers will commonly use stock images, adding more personality, interest, and action to an image without having to do their own photoshoot. A royalty-free license for such an image will entitle the buyer to a particular amount of use. With our services, you can select from several download packages, even down to a single image, under a Standard or Extended license. A quick search on our website will help you quickly find the perfect image for your creative projects.
Uncover visual aspiration across categories for your business
Explore a world of visual inspiration using our wide range of stock image categories tailored for various interests and industries. In fact, trending themes like interiors, birthday celebrations, lifestyle, fresh foods, and drinks, among others, are the most popular, making us a modern, innovative, and in demand photo stock. We can provide reassurance that our process of curation means that our photos are visually appealing as well as tell a compelling narrative. Our curated collections showcase the latest trends where each category has its personal tale ready to upgrade your creative endeavors. Simply browse the categories, download, and start using your new images immediately.
Our photo stock service offers more than just great images
Enhance your photography endeavors by using a leading online picture stock. Enjoy an endless stream of the latest trending content and an assortment of unique pictures you will not find anywhere else. You can also take advantage of our complimentary gallery, containing over 100 pages of free visuals on everything from flowers to hygiene, cooking, and much more. Learn how to properly use your downloaded stock images thanks to our blog section, which gives helpful hints, tips, and inspiration for styling, advertising, and marketing your designs. As a result of offering our users these additional features and benefits, our services stand out, so you will, too.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
It’s all about the buying experience on our stock image platform
Nothing is more frustrating when you’re online shopping than a platform that is not user-friendly and does not offer value for money in return for the goods or services on offer. That’s where our trusted photo stock site differs from the rest. From easy navigation for finding your perfect images, to a hassle-free download and payment process, the buying experience is exceptional. Choose from Standard or Extended on-demand pricing plans that offer greater value for money on bulk purchases. Each license plan has a breakdown of what’s allowed in terms of image use, so you can determine which is the right option for you.