
Pile of different pills on mint background, flat lay. Space for text
Stock Photo ID: 1378740
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Pile of different pills on mint background, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 29 Jun 2023
You may use our image “Pile of different pills on mint background, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aidantibioticbackgroundcapsulecarechemicalcolorfulcopycuredifferentdiseasedoctordosedrugflatgrouphealhealthcarehelpilllaymanymedicalmedicinemedsmintobjectpainpainkillerpharmaceuticalpharmacypilepillsprescriptionrecoveryreliefremedyservicesickspacesupplementtablettexttexturetherapytoptreatmentviewvitaminwhite
Benefit from the visual variety and creativity of Africa Images
Africa Images offers a unique royalty-free stock photo service for content providers and business owners. Our images go through a rigorous QA process before we upload them to the website; additionally, our specialized team tracks the current trends and popular topics to provide various resources for users, such as the “Featured collections” gallery. From photographers to models, retouching artists, and stylists, our professional photo shoots cover even the smallest details, including the furniture, food, and technology shown in the photographs. We endeavor to enhance your brand by building trust and credibility, differentiating you from other competitors.
When it comes to crafting campaigns, images speak louder than words
Photography is everywhere, and it can make us think, connect, engage, act, and even stop in our tracks. Whether you are a business owner or a content creator looking to elevate your work, we believe that with the right image, you can convey more information than words. This is why we go to great lengths to ensure our photos are of the highest quality, showcasing the diversity of images available but also license options. If you want your audience to connect on a deeper level with your brand, our royalty-free images will compel them to explore further and convert.
Find diverse stock image collections to elevate your work
Regardless of what industry you are in, our platform has diverse images that cover all kinds of everyday activities and even specialist subjects. Explore the hottest topics and trending themes in popular categories including interiors, home decor, salons, spas, food, drinks, and much more. When you browse on a selected category, you will find photo collections grouped by the same theme. With our convenient filters and keyword functionality, you can refine your results using our search page. We guarantee you will find the perfect picture in one of our quality collections that matches with your idea or specific campaign.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get better value for money with our affordable pricing plans
Purchasing high-resolution stock images should be easy to find, purchase, and download from an online supplier. That’s why we have budget-friendly on-demand Standard and Extended license packages that offer great value for money and bulk savings. Our Standard pack allows for our content to be used in digital and print reproductions, as well as outdoor advertising and personal non-commercial use. With Extended, you get all this and more with the ability to use our striking visuals in business or commercial designs, digital templates for sale and distribution, and products that are for sale or distribution.