
Piece of tasty halva with pistachios isolated on white, top view
Stock Photo ID: 1636974
Large 4611 × 4256 px, JPG 162.67 × 150.14 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Piece of tasty halva with pistachios isolated on white, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4611 × 4256 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 12 Dec 2023
You may use our image “Piece of tasty halva with pistachios isolated on white, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
arabicbackgroundbreakfastcandyconfectionerycookcuisineculinarycutdeliciousdesserteasteasterneatfoodfreshgourmetgreekhalavahhalawahalvahalvahhalwahealthyhomemadeingredientisolatedmealnaturalnutritionnutsobjectoneorganicorientalpiecepistachiosrecipesesamesnacksugarsunflowersweettastytoptraditionaltreatturkishviewwhite
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
Learn how creators can navigate the image landscape responsibly
In an increasingly visual world, high-quality photos and illustrations are always in high demand. Content creators such as bloggers, marketers, and designers can greatly benefit from using stock photos, which can significantly enhance your projects. With our vast archive of ready-made images, using our services is one of the best ways to legally use licensed photos for your campaigns. These royalty-free images are cleared for commercial and non-commercial use and can be used across industries and creative formats such as billboards, social media, stationery, websites, and signage. Consider us as your visual partner in navigating the image landscape responsibility to boost your business opportunities.
Be spoilt for choice with our unique stock picture categories
Learn more about our carefully curated and creative approach to image selection, where we offer numerous image categories. We have themes covering daily lifestyle as well as sophisticated subject matter, so you can find the right images that reflect your vision and perfectly illustrate your projects. With regularly updated collections, our photos are always relevant and up to date, covering the latest trends and popular materials including holidays, business, seasonal, interior design, and décor. Every single image on our platform becomes a visual masterpiece carefully put together to provide you with an aesthetic experience beyond the expectation of photo stocks.
Learn our latest tips and tricks for your stock photos on our blog
Our royalty-free stock photo platform is the ultimate source for all your visual needs. Find an endless flow of daily new content updates, ensuring your brand is always looking its best. Users can pay a visit to our free gallery that highlights various images over a hundred pages from everyday occurrences to one-off exceptional events and activities. Looking to make the most out of your new pictures? Be inspired by our blog, which will provide top tips on how your images can benefit your company or project work. We consistently raise the bar, so expect the unexpected when you choose us.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.