![Piece of ripe juicy pomegranate and green leaves on white background Photo of Piece of ripe juicy pomegranate and green leaves on white background](https://static.africaimages.com/photos/0/A/0AJ7SEHWb2ivclwMMaWvqnBPC/0AJ7SEHWb2ivclwMMaWvqnBPC_normal.jpg)
Piece of ripe juicy pomegranate and green leaves on white background
Stock Photo ID: 835284
Large 4866 × 3159 px, JPG 171.66 × 111.44 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Piece of ripe juicy pomegranate and green leaves on white background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 4866 × 3159 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 2 Nov 2021
You may use our image “Piece of ripe juicy pomegranate and green leaves on white background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
antioxidantbackgroundbrightcolorcutdeliciousdieteatexoticfoodfreshfruitgastronomygourmetgrainsgreengrenadinehealthyisolatedjuicejuicyleavesnaturalnobodynutritionobjectorganicpiecepomegranateproductredripesectionseedseedsslicesnacksourstudiosweettastytexturetreattropicalveganvegetarianvitaminswhiteyummy
Bring your visual content to life with stock photos from Africa Images
At Africa Images, we offer a range of royalty-free stock pictures that are ideal for your upcoming projects. Among our large collection of images, you will find photos that are suitable for education, marketing, design, and advertising purposes in a variety of different sizes and resolutions. As well as galleries for different themes, including drinks, transportation, and seasons, our “Featured collections” section provides visual inspiration on popular photos recommended for use in your campaigns. Use Africa Images as your one-stop shop for constantly updated, high-quality visuals and exceptional service you can rely on to improve your promotions and sales.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Diverse photo collections to make inspired ideas a reality
Discover new paths of creativity for your business using our broad range of stock image categories, each providing access to new visual narratives. These trendsetting themes include interiors, business, holidays, salons, seasonal, and drinks, and much more. These categories are not just about pictures but an experience that broadens your imagination of what’s possible for your marketing and advertising campaigns. With millions of photos available on our platform, there’s sure to be the perfect image in our collections to reflect your vision. From A-Z, every category gives you the opportunity to explore, create, and propel your projects to new heights.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Business owners love our photo stock for the purchasing experience
We are a trusted supplier of stock images because we offer our users an efficient and enjoyable experience when using our platform. This, combined with payment protection and cost-effective pricing plans, means that you get a full suite of features and benefits that you likely won’t find with other providers. From browsing to selecting, purchasing, downloading, and using your new images, it only takes a matter of minutes from start to finish. Review our license comparison summary for what is allowed and included with each package so you know whether our Standard or Extended options are best for your creative requirements.