![Piece of cheese on white background, top view. Natural food high in protein Photo of Piece of cheese on white background, top view. Natural food high in protein](https://static.africaimages.com/photos/R/w/RwI8nUjybAylRAmUpbb8eKoEN/RwI8nUjybAylRAmUpbb8eKoEN_normal.jpg)
Piece of cheese on white background, top view. Natural food high in protein
Stock Photo ID: 312964
Large 6720 × 6321 px, JPG 237.07 × 222.99 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Piece of cheese on white background, top view. Natural food high in protein”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 6321 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 7 Nov 2018
You may use our image “Piece of cheese on white background, top view. Natural food high in protein” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbalancedbreakfastcalciumcheesecookingcuisinedairydietdietarydietingeateatingfoodfreshhealthhealthyhighingredientisolatedlifestylelunchmealnaturalnobodynourishingnourishmentnutrientnutrimentnutritionnutritionalnutritiousobjectorganicpieceproductproteinrationrichsnacksporttastytopvegetarianviewvitaminwhiteyellow
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Create visual resonance for your brand with royalty-free images
Visual resonance is when you make a person feel that they are in the image or fully experiencing it. When achieved, brand resonance can create an unprecedented level of advocacy among consumers who become not only buyers but also promoters and fans of the brand. A positive experience will help in laying a foundation for the establishment of long-lasting relationships with your brand. With an extensive collection of high-quality images available on our site, your visuals can portray the desired message to your targeted audience. Get your audience to be curious, and they will stay interested in your business for the long term.
Boost your brand profile with our versatile image categories
Learn how we bring together stock images under various categories. No matter what topic or idea you are working on, we will have a suitable collection to fit. Themes may include everything from the simplicity of our daily routines to trending and popular topics such as interior design, sports, spas, food, holidays, and much more. Our collections are updated regularly, which means you are getting the most current visuals — helping you to keep ahead of the competition. Every one of our pictures is a work of art, selected with great attention to detail, providing you with something far above the average photo stock.
Stay ahead of visual trends and competitors with our photo stock
Take advantage of the services of a leading online photo stock and liberate your creativity. Explore a constant flow of new content with access to some exclusive images available only here. High-quality photos are always in high demand, with professionals benefitting from new and exciting images to use in their work — and ours are no exception. Visit our free image gallery containing over 100 pages of unique and inspiring free pictures and get updated on our blog, where we share useful information regarding how to use stock images for business growth and content creation. These are just some of the many benefits of our platform.
Our robust security measures will provide complete peace of mind
We are a recognized provider for stock image seekers prioritizing the most secure environment for their personal data and financial safety. We have put strong security procedures in place to make this a secure platform for users. The site is designed to be user-friendly, making the search and download process easier and more efficient. We are renowned for our outstanding customer service and rapid response to inquiries, helping us maintain an excellent reputation. Putting a strong emphasis on a seamless user experience and site safety, we are proud to be one of the most sought-after providers of high-quality pictures.
We provide a pleasant shopping experience on our easy-to-use site
Browsing website after website online for the best stock images can be time-consuming and frustrating. That’s not the experience you will have with our platform. From start to end, you will find sourcing quality and diverse photos a breeze thanks to simple navigation and secure payment processing. Available in a Standard or Extended license form, our on-demand pricing packs offer great value for money, with savings to be made on the more pictures you download. We make it easy and clear to understand which type of license you will require based on how you plan to use your new visuals.