![Piece of burnt paper with word Genocide on grey jacket, top view Photo of Piece of burnt paper with word Genocide on grey jacket, top view](https://static.africaimages.com/photos/V/B/VByoVeWVkHEqU0VwhDuLUZ0Hb/VByoVeWVkHEqU0VwhDuLUZ0Hb_normal.jpg)
Piece of burnt paper with word Genocide on grey jacket, top view
Stock Photo ID: 1118560
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Piece of burnt paper with word Genocide on grey jacket, top view”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 7 Dec 2022
You may use our image “Piece of burnt paper with word Genocide on grey jacket, top view” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
aggressionannexationarmyassumptionbackgroundbattleburntcapturecasualtiescivilconceptconflictconquestcrisisdangerdangerousdeathdenazificationdestructionfabricfascismgenocidegreyindependenceinvasionjacketmilitarynationnazisnobodyobjectoccupationpaperpeacepeacekeepingpiecesadnesstoptorntragedytragicvictimsviewwarwarfareweaponswordworld
Africa Images’ photo stock is the key to your visual success
The premium stock photo content available at Africa Images is always growing. All our images go through strenuous quality procedures to ensure they are of the highest quality before we upload them to our photo galleries. Our experts monitor trending and popular themes and, together with a team of models, photographers, stylists, and editors, carry out photo shoots that result in the exceptional visuals you see today on our site. Eye-catching imagery that attracts audiences is a crucial element that can help drive sales or improve brand awareness of your business, contributing greatly to business objectives. These royalty-free photos are particularly useful for designers, teachers, bloggers, marketers, and creators wanting to produce high-quality, professional content.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Enhance your creative output with our quality image collections
With a vast collection of stock image categories depicting different forms of life ranging from the ordinary to the out-of-the-ordinary, your business will be able to create intriguing visual narratives. No matter what idea you have in mind, we offer millions of modern photos readily accessible on our site, enabling ease in finding appropriate images for your upcoming projects. Search for popular and trending options in topics such as home interiors, happy families, salons, traveling, and holidays. With great care and consideration, we upload every image onto our platform and ensure that it raises the quality of your brand’s creative output.
Benefit from constant new visual content with our photo stock
Trust us as a leading photo stock to help you produce modern, exciting, and highly engaging visual content using our latest and trending images. Be wowed with a continuous supply of daily updated contemporary and popular photos. Browse our free gallery, which showcases many themes and topics over 100 pages, and check out our blog posts with recommendations and top tips on how to use stock images in your marketing strategy or artistic endeavors. On top of our high-quality photos, these additional features and benefits of our service mean more value for money and creative inspiration for our valued users.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get quality stock images for less with our on-demand pricing plans
Great stock images can be expensive, which is why we offer our customers two different license options that cater to their budget and image requirements. Depending on how you intend to use your new pictures, you can opt for a Standard or Extended pack — both of which come with bulk savings. The Extended option is ideal if you need unlimited downloads for printed reproductions or outdoor advertising and allows you to use the photos for products on sale or distribution, digital templates for sale or distribution, and for business and commercial space designs. Our handy license comparison chart will make it easier to find your ideal pricing plan.