Pharmacist giving medicine to customer in drugstore
Stock Photo ID: 93684
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: model and property release for this stock photo is signed with Africa Studio.
What is an image “Pharmacist giving medicine to customer in drugstore”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 17 Dec 2019
You may use our image “Pharmacist giving medicine to customer in drugstore” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
adultagedapothecarybackgroundbagbusinessbuyingcarecaucasianchemistclientclinicconsumercustomerdispensarydoctordrugdrugstorefemalegivinghappyhealthhelphospitalindoorsmaturemedicalmedicamentmedicationmedicinemiddlepaperpatientpeoplepharmaceuticalpharmacistpharmacyprescriptionretailsalesellingshopsmilingstoragestoretalkingtechnicianwomanworkyoung
Elevate your brand awareness with Africa Images’ stock photography
A subsidiary project of Africa Studio, Africa Images is distinctive by its ability to produce powerful visuals. We created something unique and inspiring in 2008 by combining an innovative stock photography approach with exceptional service performance. Our image library has collections for many trending and popular topics and is suitable for both commercial as well as non-commercial projects. These royalty-free images are an invaluable resource for marketers, designers, bloggers, business owners, and anyone hoping to raise the quality of their content. We can be a key partner in improving the impact of your marketing and advertisements by enhancing your brand’s creative output.
Safeguard your business with our royalty-free licensed visuals
As a reputed supplier of high-quality stock photography, business owners have peace of mind when it comes to sourcing and downloading licensed visuals from our site. Regardless of what you need photo content for, there are unlimited options for the pictures you get. As well as being high-resolution and versatile for promotional activities such as marketing, advertising, social media, and web design, our pictures promote responsible image use and will leave a lasting impact not only on your audience but also in licensing on the digital and traditional landscape. Discover today how your image choices will leave a positive legacy.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Make your budget stretch further with our affordable pricing
We all want to make our money go that little bit further, which is why our photo stock provides not only high-quality visuals but also different payment plans that provide bulk savings the more you download. For our Standard on-demand pack, you can get 10 high-resolution images for as little as $25 — a mere $2.50 per image. Needing to do more with your pictures? The Extended option license allows for unlimited printed reproductions as well as outdoor advertising. Unlike the Standard plan, you can also use your downloads on products for sale or distribution, digital templates for sale or distribution, and designs for a business or commercial space.