
Paper cutout of kidneys and different healthy products on green background, flat lay. Space for text
Stock Photo ID: 979675
Large 6720 × 4480 px, JPG 237.07 × 158.04 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Paper cutout of kidneys and different healthy products on green background, flat lay. Space for text”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 6720 × 4480 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 17 Jun 2022
You may use our image “Paper cutout of kidneys and different healthy products on green background, flat lay. Space for text” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
anatomyantioxidantarugulaasparagusbackgroundbalanceberriescarecolorconceptcopycutoutdeliciousdietdifferentdiseaseeatflatfoodfreshfruitgreenhealthyhumaningredientkidneykidneyslaylemonmanymedicinenaturalnutritionobjectonionorganorganicpaperproductspumpkinrawrenalseedsspacetastytexttopvegetablesviewvitamin
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
Why you should use highly visual stock images for business growth
Using visual content for marketing and advertising purposes helps to catch an audience’s attention, create an emotional response, increase shareability, and easily represent complex information in a more digestible and engaging way. The benefits would not only make your business and materials stand out in a competitive setting but would also fuel long-term growth. Our vast collection of royalty-free photos is relevant for any business and will provide content creators with ample choice and inspiration. Help bring your creative ideas to life and see the demand for your products and services grow with the help of our high-resolution stock images.
Visual brilliance awaits exploration with our photo collections
Our image catalogs comprise over a million stock pictures that are frequently updated so you can browse through the latest photos on different topics, including trending categories such as interior design, home décor, salons and spas, business, and happy families among others. The process of vetting these collections involves evaluation by our experts and the selection of only the highest-quality images available for download on the site. Such a wide variety of categories ensures our user's speed and efficiency in locating the ideal shots required for their upcoming promotions. Let our collections inspire you to celebrate the diversity of life.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.