
Paper cup with hot coffee on green grass outdoors, closeup. Takeaway drink
Stock Photo ID: 1019253
Large 5760 × 3840 px, JPG 48.77 × 32.51 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Paper cup with hot coffee on green grass outdoors, closeup. Takeaway drink”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 1 Aug 2022
You may use our image “Paper cup with hot coffee on green grass outdoors, closeup. Takeaway drink” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
arabicaaromaticawaybackgroundbeverageblackblankblurredbreakbrowncaffeinecardboardcloseupcoffeecontainercraftcupdaydeliciousdesigndisposabledrinkenergyespressofastflavorfreshgograssgreenhealthheathotlawnlidlifestylemorningnobodyobjectoutdoorspaperrecyclingrefreshingtaketakeawaytakeouttastetastyteatemplate
Africa Images photo stock: where content creation comes to life
At Africa Images, we create compelling visual material to make a lasting impression on your audience. Our stock image collections are not only wide and varied, but we add new images every day to give you more choices. From beauty to DIY and gardening, we have royalty-free stock images, pictures, and illustrations that can help you in meeting your company’s goals. We keep up with the latest trends and popular content and create affordable photos that are perfect for any project, whether commercial or non-commercial. We are proud to be by your side, strengthening your brand awareness and ensuring your ongoing success.
Let your content showcase the emotive power of stock images
Content building is one of the most important aspects of today’s marketing and communication in an almost exclusively digital world. Regardless of the type of content, whether it is social media posts, blog posts, website content or even presentations, the visual impact of these materials is crucial to gain the audience’s attention. With time, stock photos have increased in popularity, becoming an effective way of improving the quality and power of content, as well as being educational, engaging, and entertaining. We have images to suit the visual style of your brand, helping to create the desired emotions and response from your target audience.
Looking for comprehensive stock image categories? You've found them
Ensure you take the time to go through the diverse imagery options in our exhaustive royalty-free collections. When it comes to categories, these include anything from everyday life events to trending interior design, happy families, fresh foods, and so much more. No matter what image you are looking for; we’ve got you covered from A to Z. Whatever topic or inspired idea for creativity; you will always be able to find suitable images which bring your thoughts and concepts to life. These carefully curated collections will contribute towards the overall aesthetic appeal, successful implementation, and engagement of your projects.
We offer helpful content as well as the latest stock images
Discover our extensive stock image collections to help improve your creative and artistic abilities. Here, you will find an endless supply of original content featuring several unique images that can only be found on our platform. Visit our free gallery, where content creators will find a vast supply of quality photos across a number of themes and styles. By using the helpful dropdown options, you will be able to find exactly what you are looking for. You can also learn valuable skills by reading our blog, which offers the latest tips and tricks on using stock images in business and other work endeavors.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get quality stock images for less with our on-demand pricing plans
Great stock images can be expensive, which is why we offer our customers two different license options that cater to their budget and image requirements. Depending on how you intend to use your new pictures, you can opt for a Standard or Extended pack — both of which come with bulk savings. The Extended option is ideal if you need unlimited downloads for printed reproductions or outdoor advertising and allows you to use the photos for products on sale or distribution, digital templates for sale or distribution, and for business and commercial space designs. Our handy license comparison chart will make it easier to find your ideal pricing plan.