Origami art. Handmade paper cranes on pink background
Stock Photo ID: 1149382
Large 5760 × 3840 px, JPG 203.2 × 135.47 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Origami art. Handmade paper cranes on pink background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5760 × 3840 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 11 Nov 2022
You may use our image “Origami art. Handmade paper cranes on pink background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
animalartartisticbackgroundbeautifulbirdblueclassiccloseupcolorcopycraftcranescreateculturedecorationdecorativedesignfigurefoldedfoldingfungeometrichandcrafthandmadehobbyhopeideajapanjapaneseleisureminimalminimalistnobodyobjectorigamipaperpinkplayplayingshapesimpleswansymboltoytraditionaltranquilwingwingsworkshop
Discover the latest and best-trending stock photos at Africa Images
Africa Studio — your home of exceptional pictures — brings you Africa Images, a handpicked selection of high-resolution stock photos compiled by our top photographers and creators. We offer a range of different sizes and resolutions so that you can find the perfect image for your projects. Our dedicated team constantly tracks recent trends and popular materials and updates our photo collections daily with the latest images. Our visuals will make your creative ideas come to life and help you have an unforgettable and engaging marketing campaign. Use our royalty-free images to increase your brand’s visibility and raise product demand.
High-quality stock photos can be transformative across industries
High-quality stock photos can play a significant role in meeting visual demands in various industries, from advertising and web design to journalism and marketing. They have the power to capture the essence of a brand and effectively convey messages, and evoke emotions. Our royalty-free images enable content creators and business owners alike to discover high-resolution pictures and illustrations that perfectly align with their project’s needs. Not only will you be able to find cost-effective and unique pictures that fit your creative vision, but ones that also adhere to the licensing and usage rights associated with the image.
Let our quality image collections motivate your creativity
Embark on a visual tour of our many stock photo categories that bring out the unique aspects of everyday and not-so-everyday life. No matter what theme you are working on, or what idea you have in your mind, we will have a suitable image to fit your requirements in one of our extensive collections. From the most popular and trending categories to the daily essentials, these categories are regularly updated so that your materials are always up to date and stand out in a crowded marketplace. We celebrate the beauty of life with our diverse and carefully curated collections.
Content creators love our additional image resources and services
Enter a world of visual perfection with our quality photo stock. We supply our platform users with a constant flow of new content, and some exclusive images they will not find anywhere else. Other advantages of our service include our large and free gallery containing over 100 pages of images, which can be filtered to find exactly what you need. Unsure how best to use your newly downloaded pictures? Our blog contains useful advice and tips on how to maximize them in both commercial and non-commercial projects. We don’t just offer the best images and value for money; we offer the full package.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Choose from different pricing plans based on your visual needs
For content creators who are looking for the best stock images, as well as the most budget-friendly, you will find everything you need and more on our user-friendly platform. You can take advantage of the bulk savings on offer with both our Standard and Extended packages, which make it more cost-effective the more you buy. Unsure which license you need for your proposed image use? Our comparison section will give you all the guidance and confirmation you need when it comes to selecting your required package. Lucky enough to have a promotional code? Be sure to use it for even more savings.