
Open cardboard box with delicious pizza on white background. Food delivery
Stock Photo ID: 328902
Large 5292 × 4468 px, JPG 186.69 × 157.62 cm
Standard License
/ image
/ image
DescriptionImage Usage
What is an image “Open cardboard box with delicious pizza on white background. Food delivery”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5292 × 4468 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.
Upload date: 2 Jan 2019
You may use our image “Open cardboard box with delicious pizza on white background. Food delivery” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
backgroundbakedboxbrowncardboardcartoncheesecontainercookcopycuisinedeliciousdeliverydesigndougheatfastfoodfreshhotingredientisolateditalianjunklunchmealmeatnutritionobjectoliveopenpackagepackagingpaperpastrypepperonipizzapizzeriareciperestaurantsausageservicespacetakeawaytastytexttogotomatovegetablewhite
Create memorable and engaging creative projects with Africa Images
Our goal at Africa Images is to create and supply exceptional stock images that will enhance your brand’s reputation. If you are a business owner or marketer, you understand that your advertising efforts require high-quality photography that can be used royalty-free in your creative campaigns. We can provide a range of sizes and resolutions, alongside a huge supply of themes and collections to ensure you find the perfect image. With additional benefits and service features, including free images, sharing previews, and unlimited downloads, now is the ideal time to enhance your brand visibility, drive engagement, and ultimately boost your sales.
Let us provide royalty-free visual investments for your brand
High-resolution stock photos exist so that content creators and businesses can easily find an image that’s already available, offering convenience and saving time, resources, and money. Once an image is downloaded from the website, you will have access to it immediately, which means no waiting for post-production editing before you can start to use your photo. This is just one of the many features and benefits of our service to elevate your brand’s creative output and appeal. These royalty-free photos are an invaluable resource and investment for designers, business owners, teachers, bloggers, and marketers wanting to produce high-quality, professional content.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
Our additional services make us a leading photo stock resource
You can rely on our photo stock to supply the latest and greatest high-quality images. Business owners, designers, marketers, and bloggers can discover a never-ending source of daily updated content with a variety of unique pictures only available here. Check out our free gallery featuring various themes that will provide plenty of visual inspiration for upcoming projects. You can select by orientation, image type, isolation, and color to find the perfect photo for your creative requirements. Read our blog posts to keep up to date on how best to use your newly downloaded stock images for business and artistic purposes.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
From finding your perfect image to making a payment, we make it easy
Time is precious, so why waste it looking at photo stock websites that don’t offer a great customer experience or quality visuals? On our platform, you can rest assured that our collections are not only regularly updated, but that the images available for purchase are cost-effective with one of our on-demand packs. Priced from just $5 for one image with our Standard option or $25 when downloading a bulk of 10 photos, there are savings to be made and more creativity to be unleashed in your work. Unsure what option you require? Check out our license comparison section for full clarity and reassurance.