Modern ultraviolet lamp glowing on black background
Stock Photo ID: 701768
Large 5621 × 3832 px, JPG 198.3 × 135.18 cm
Standard License
/ image
/ image
DescriptionImage Usage
Release info: property release for this stock photo is signed with Africa Studio.
What is an image “Modern ultraviolet lamp glowing on black background”? It is stock photography for your personal and commercial projects. You can buy and download it on Africa Images photo stock in high resolution up to 5621 × 3832 px or even form your own collection. Put the heart under every photo you like for an easy review and match. Save not only time but money as well.Upload date: 1 Apr 2021
You may use our image “Modern ultraviolet lamp glowing on black background” for project designs or as it is in line with either a Standard or Extended License. The Standard License covers such purposes as advertising, digital compositions, and non-business use and allows up to 500,000 print copies. The Extended License allows the same, but with unlimited print rights, and lets you use the downloaded items for commercial purposes, such as merchandise, product sale, or free distribution. Find out more on the Pricing page.
Find stock photos using keywords
airappliancebackgroundbacteriablackcarecleancliniccoronacoronaviruscoviddevicedisinfectelectriceliminateepidemicequipmentglowinghealthhealthyhospitalhygieneillustrationinnovationlamplightmedicmedicalmedicinemodernobjectpreventionprofessionalpurificationquartzraysafetysterilesterilisationsterilizationsterilizesterilizersterilizingtechnologytoolultraultravioletuvuvcvirus
Raise your brand awareness with Africa Images’ royalty-free visuals
At Africa Images — a part of Africa Studio, we take great pride in our superior standards not only for our services but also for the vast collection of royalty-free stock images available on our website. You will find individual image collections for fashion, lifestyle, or even tech, which are the perfect source of inspiration for those who are building websites, designing their marketing campaigns, and any artwork. We also provide additional features such as free images, the ability to share previews, and unlimited downloads, which make us popular amongst content creators. You can sell more of your products by promoting your brand and creating a powerful visual identity.
Discover how pictures can drive brand engagement and loyalty
When done professionally and with purpose, images can drive significant engagement and brand recognition for your business. The lasting presence of an image can enhance a piece of content’s reach while also keeping it alive in the reader’s mind. Investing in high-quality, royalty-free images could be different between potential customers choosing your brand over competitors. If you want your campaign or next piece of content to drive maximum impact and be faster and more effective, our photo stock will enable you to create impressive visual strategies. You can trust in our professional photography to enhance your advertisement campaigns or promotions.
Explore diversity in visuals with high-quality image collections
We are no ordinary photo stock. Our image categories depict a unique story with every picture. Think of a theme and we will have it. Browse through the latest trends in home decor inspiration, spa, and salon shots, as well as appealing food & drink snaps. As well as being modern, extensive, and of high quality, our collections are regularly updated, so we can guarantee you're always downloading the latest visuals. For your convenience, we also arrange these by category. To give our users a captivating and enriching visual experience, we carefully pick out only the most striking images for display.
Enjoy additional value for your money with added features
Revolutionize your creative journey with popular and trending stock images. There are always fresh visuals updated daily, highlighting the uniqueness and quality of the collections available on our site. Visit our complimentary gallery with over 100 pages of outstanding pictures that be filtered to find the ideal image type. A read of our blog posts with helpful tips and tricks on how to use stock photos in creative work is an invaluable resource for getting the most out of your downloads. With these added value extras, we go above and beyond with our service to meet and exceed your expectations.
Reliability is a guarantee that goes beyond pixels, and each click
Our trusted photo stock offers more than most online providers when it comes to the full features and benefits on offer. A convenient, easy-to-use interface makes exploration enjoyable and adds to your overall experience as you examine a world of beautiful images. These aspects are complemented by a group of experienced support professionals who will deal promptly and happily with your image needs. So, take advantage of our platform and enter a domain where security, user-friendliness at every turn, and steadfast service make your browsing of online pictures both first-rate in terms of quality as well as provide complete confidence.
Get great savings when you buy in bulk from our photo stock
Not only is the process of finding quality images on our website quick, simple, and inspiring, but you will also be pleasantly surprised by our prices. It can be daunting when trying to navigate how image licenses work, but our useful comparison section outlines exactly what usage rights are included with our Standard and Extended on-demand pricing packs. With both options, the more pictures you purchase, the more value you will get with bulk savings. Wondering how you can maximize our content on popular printed reproductions and outdoor advertising? Then, the Extended license with unlimited use is the right choice for you.